Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3162
Gene name Gene Name - the full gene name approved by the HGNC.	Heme oxygenase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HMOX1
Synonyms (NCBI Gene) Gene synonyms aliases	HMOX1D, HO-1, HSP32, bK286B10
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its subs

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1601739478	->G	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004719	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20127796
MIRT001455	hsa-miR-16-5p	pSILAC	18668040
MIRT017714	hsa-miR-335-5p	Microarray	18185580
MIRT019368	hsa-miR-148b-3p	Microarray	17612493
MIRT021967	hsa-miR-128-3p	Microarray	17612493
MIRT022531	hsa-miR-124-3p	Microarray	18668037
MIRT023272	hsa-miR-122-5p	Western blot;qRT-PCR	20633528
MIRT023272	hsa-miR-122-5p	Microarray	17612493
MIRT023697	hsa-miR-1-3p	Proteomics	18668040
MIRT029307	hsa-miR-26b-5p	Microarray	19088304
MIRT001455	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT054754	hsa-miR-24-3p	Luciferase reporter assay, Western blot	24854275
MIRT462676	hsa-miR-5193	HITS-CLIP	23824327
MIRT462675	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT462674	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT462673	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650816	hsa-miR-4448	HITS-CLIP	23824327
MIRT462656	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT462655	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT462654	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT462653	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT462652	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650815	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT462650	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT462683	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462682	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462681	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462680	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT462679	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT021967	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT462678	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT462677	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT462676	hsa-miR-5193	PAR-CLIP	23592263
MIRT462675	hsa-miR-660-3p	PAR-CLIP	23592263
MIRT462674	hsa-miR-6734-3p	PAR-CLIP	23592263
MIRT462673	hsa-miR-3667-3p	PAR-CLIP	23592263
MIRT462672	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT462671	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT462670	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT462669	hsa-miR-4721	PAR-CLIP	23592263
MIRT462668	hsa-miR-7976	PAR-CLIP	23592263
MIRT462667	hsa-miR-3135b	PAR-CLIP	23592263
MIRT462666	hsa-miR-3612	PAR-CLIP	23592263
MIRT462665	hsa-miR-650	PAR-CLIP	23592263
MIRT462664	hsa-miR-1291	PAR-CLIP	23592263
MIRT462663	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT462662	hsa-miR-3652	PAR-CLIP	23592263
MIRT462661	hsa-miR-4430	PAR-CLIP	23592263
MIRT462660	hsa-miR-4492	PAR-CLIP	23592263
MIRT462659	hsa-miR-4498	PAR-CLIP	23592263
MIRT462658	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462657	hsa-miR-762	PAR-CLIP	23592263
MIRT462656	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT462655	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT462654	hsa-miR-4691-5p	PAR-CLIP	23592263
MIRT462653	hsa-miR-6792-3p	PAR-CLIP	23592263
MIRT462652	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT462651	hsa-miR-4443	PAR-CLIP	23592263
MIRT462650	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT733875	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32602850
MIRT735144	hsa-miR-135a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32762552
MIRT735145	hsa-miR-135b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32762552
MIRT462676	hsa-miR-5193	HITS-CLIP	23824327
MIRT462675	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT462674	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT462673	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650816	hsa-miR-4448	HITS-CLIP	23824327
MIRT462656	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT462655	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT462654	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT462653	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT462652	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650815	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT462650	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT462683	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462682	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462681	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462680	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT462679	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT021967	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT462678	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT462677	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT462676	hsa-miR-5193	PAR-CLIP	23592263
MIRT462675	hsa-miR-660-3p	PAR-CLIP	23592263
MIRT462674	hsa-miR-6734-3p	PAR-CLIP	23592263
MIRT462673	hsa-miR-3667-3p	PAR-CLIP	23592263
MIRT462672	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT462671	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT462670	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT462669	hsa-miR-4721	PAR-CLIP	23592263
MIRT462668	hsa-miR-7976	PAR-CLIP	23592263
MIRT462667	hsa-miR-3135b	PAR-CLIP	23592263
MIRT462666	hsa-miR-3612	PAR-CLIP	23592263
MIRT462665	hsa-miR-650	PAR-CLIP	23592263
MIRT462664	hsa-miR-1291	PAR-CLIP	23592263
MIRT462663	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT462662	hsa-miR-3652	PAR-CLIP	23592263
MIRT462661	hsa-miR-4430	PAR-CLIP	23592263
MIRT462660	hsa-miR-4492	PAR-CLIP	23592263
MIRT462659	hsa-miR-4498	PAR-CLIP	23592263
MIRT462658	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462657	hsa-miR-762	PAR-CLIP	23592263
MIRT462656	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT462655	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT462654	hsa-miR-4691-5p	PAR-CLIP	23592263
MIRT462653	hsa-miR-6792-3p	PAR-CLIP	23592263
MIRT462652	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT462651	hsa-miR-4443	PAR-CLIP	23592263
MIRT462650	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT1050132	hsa-miR-1304	CLIP-seq
MIRT1050133	hsa-miR-200b	CLIP-seq
MIRT1050134	hsa-miR-200c	CLIP-seq
MIRT1050135	hsa-miR-217	CLIP-seq
MIRT1050136	hsa-miR-2467-5p	CLIP-seq
MIRT1050137	hsa-miR-3065-5p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT1050139	hsa-miR-3163	CLIP-seq
MIRT1050140	hsa-miR-3188	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT1050142	hsa-miR-371-3p	CLIP-seq
MIRT1050143	hsa-miR-3922-5p	CLIP-seq
MIRT1050144	hsa-miR-3929	CLIP-seq
MIRT1050145	hsa-miR-3975	CLIP-seq
MIRT1050146	hsa-miR-429	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT1050149	hsa-miR-4418	CLIP-seq
MIRT1050150	hsa-miR-4419b	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050152	hsa-miR-4478	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050154	hsa-miR-4663	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT1050157	hsa-miR-4753-5p	CLIP-seq
MIRT1050158	hsa-miR-485-5p	CLIP-seq
MIRT1050159	hsa-miR-509-3-5p	CLIP-seq
MIRT1050160	hsa-miR-509-5p	CLIP-seq
MIRT1050161	hsa-miR-548ac	CLIP-seq
MIRT1050162	hsa-miR-548ae	CLIP-seq
MIRT1050163	hsa-miR-548aj	CLIP-seq
MIRT1050164	hsa-miR-548am	CLIP-seq
MIRT1050165	hsa-miR-548d-3p	CLIP-seq
MIRT1050166	hsa-miR-548x	CLIP-seq
MIRT1050167	hsa-miR-548z	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2546899	hsa-miR-1206	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT2546900	hsa-miR-1251	CLIP-seq
MIRT2546901	hsa-miR-1254	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT2546902	hsa-miR-1306	CLIP-seq
MIRT2546903	hsa-miR-148a	CLIP-seq
MIRT2546904	hsa-miR-148b	CLIP-seq
MIRT2546905	hsa-miR-152	CLIP-seq
MIRT2546906	hsa-miR-2110	CLIP-seq
MIRT2546907	hsa-miR-218	CLIP-seq
MIRT2546908	hsa-miR-3116	CLIP-seq
MIRT2546909	hsa-miR-3123	CLIP-seq
MIRT2546910	hsa-miR-3140-3p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT2546911	hsa-miR-3150a-3p	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT2546912	hsa-miR-3183	CLIP-seq
MIRT2546913	hsa-miR-3192	CLIP-seq
MIRT2546914	hsa-miR-3194-5p	CLIP-seq
MIRT2546915	hsa-miR-328	CLIP-seq
MIRT2546916	hsa-miR-3614-3p	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT2546917	hsa-miR-371b-3p	CLIP-seq
MIRT2546918	hsa-miR-3938	CLIP-seq
MIRT2546919	hsa-miR-4271	CLIP-seq
MIRT2546920	hsa-miR-4276	CLIP-seq
MIRT2546921	hsa-miR-4292	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT2546922	hsa-miR-4300	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT2546923	hsa-miR-4317	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT2546924	hsa-miR-4723-3p	CLIP-seq
MIRT2546925	hsa-miR-4725-3p	CLIP-seq
MIRT2546926	hsa-miR-4764-5p	CLIP-seq
MIRT2546927	hsa-miR-4766-5p	CLIP-seq
MIRT2546928	hsa-miR-4786-3p	CLIP-seq
MIRT2546929	hsa-miR-636	CLIP-seq
MIRT2546930	hsa-miR-642a	CLIP-seq
MIRT2546931	hsa-miR-661	CLIP-seq
MIRT2546932	hsa-miR-671-5p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT2546933	hsa-miR-920	CLIP-seq
MIRT1050128	hsa-miR-1185	CLIP-seq
MIRT2546899	hsa-miR-1206	CLIP-seq
MIRT1050129	hsa-miR-1245b-5p	CLIP-seq
MIRT2546900	hsa-miR-1251	CLIP-seq
MIRT2546901	hsa-miR-1254	CLIP-seq
MIRT1050130	hsa-miR-128	CLIP-seq
MIRT1050131	hsa-miR-1295	CLIP-seq
MIRT2546902	hsa-miR-1306	CLIP-seq
MIRT2546903	hsa-miR-148a	CLIP-seq
MIRT2546904	hsa-miR-148b	CLIP-seq
MIRT2546905	hsa-miR-152	CLIP-seq
MIRT2546906	hsa-miR-2110	CLIP-seq
MIRT2546907	hsa-miR-218	CLIP-seq
MIRT2546908	hsa-miR-3116	CLIP-seq
MIRT2546909	hsa-miR-3123	CLIP-seq
MIRT2546910	hsa-miR-3140-3p	CLIP-seq
MIRT1050138	hsa-miR-3142	CLIP-seq
MIRT2546911	hsa-miR-3150a-3p	CLIP-seq
MIRT2437630	hsa-miR-3155	CLIP-seq
MIRT2546912	hsa-miR-3183	CLIP-seq
MIRT2546913	hsa-miR-3192	CLIP-seq
MIRT2546914	hsa-miR-3194-5p	CLIP-seq
MIRT2546915	hsa-miR-328	CLIP-seq
MIRT2546916	hsa-miR-3614-3p	CLIP-seq
MIRT1050141	hsa-miR-3687	CLIP-seq
MIRT2546917	hsa-miR-371b-3p	CLIP-seq
MIRT2546918	hsa-miR-3938	CLIP-seq
MIRT2546919	hsa-miR-4271	CLIP-seq
MIRT2546920	hsa-miR-4276	CLIP-seq
MIRT2546921	hsa-miR-4292	CLIP-seq
MIRT1050147	hsa-miR-4297	CLIP-seq
MIRT2546922	hsa-miR-4300	CLIP-seq
MIRT1050148	hsa-miR-4313	CLIP-seq
MIRT2546923	hsa-miR-4317	CLIP-seq
MIRT1050151	hsa-miR-4442	CLIP-seq
MIRT1050153	hsa-miR-4493	CLIP-seq
MIRT1050155	hsa-miR-4670-3p	CLIP-seq
MIRT1050156	hsa-miR-4717-5p	CLIP-seq
MIRT2546924	hsa-miR-4723-3p	CLIP-seq
MIRT2546925	hsa-miR-4725-3p	CLIP-seq
MIRT2546926	hsa-miR-4764-5p	CLIP-seq
MIRT2546927	hsa-miR-4766-5p	CLIP-seq
MIRT2546928	hsa-miR-4786-3p	CLIP-seq
MIRT2546929	hsa-miR-636	CLIP-seq
MIRT2546930	hsa-miR-642a	CLIP-seq
MIRT2546931	hsa-miR-661	CLIP-seq
MIRT2546932	hsa-miR-671-5p	CLIP-seq
MIRT1050168	hsa-miR-873	CLIP-seq
MIRT2546933	hsa-miR-920	CLIP-seq

Transcription factors

Show/Hide all(21)

Transcription factor	Regulation	Reference
AR	Activation	11965035
BACH1	Activation	17942419
BACH1	Repression	17409198;18550526;21982894
CREB1	Repression	14523007
ERG	Unknown	10022513
ETS1	Unknown	10022513
FLI1	Unknown	10022513
NFE2L2	Activation	16551619;21982894;22484158
NFE2L2	Repression	22459801
NFE2L2	Unknown	17942419;24035498
NFKB1	Unknown	8016102
PPARA	Unknown	17413033
PPARG	Unknown	17413033
RELA	Unknown	8016102
SMAD7	Unknown	11018038
SREBF1	Unknown	17452746
STAT1	Activation	19129475
STAT3	Activation	19129475
TFAP2A	Unknown	8016102
USF1	Activation	15242350
USF2	Activation	15242350

Show/Hide all(78)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	TAS	12239590
GO:0001935	Process	Endothelial cell proliferation	TAS	12239590
GO:0002246	Process	Wound healing involved in inflammatory response	IMP	9884342
GO:0002686	Process	Negative regulation of leukocyte migration	TAS	14525760
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IBA
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IDA	7703255, 17915953
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IEA
GO:0004392	Function	Heme oxygenase (decyclizing) activity	IMP	11121422, 19556236
GO:0004392	Function	Heme oxygenase (decyclizing) activity	ISS
GO:0004392	Function	Heme oxygenase (decyclizing) activity	TAS	9884342
GO:0005198	Function	Structural molecule activity	IMP	19556236
GO:0005515	Function	Protein binding	IPI	21044950, 21597468, 32296183, 32353859, 32838362, 33060197, 35239449, 36217030
GO:0005615	Component	Extracellular space	TAS	18307065
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	19556236, 22503972
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005783	Component	Endoplasmic reticulum	TAS	3345742
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22419571, 27184847
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IMP	19556236
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006788	Process	Heme oxidation	IBA
GO:0006788	Process	Heme oxidation	IDA	17915953
GO:0006788	Process	Heme oxidation	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	17915953
GO:0006879	Process	Intracellular iron ion homeostasis	IMP	22989377
GO:0006915	Process	Apoptotic process	IEA
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IMP	9884342
GO:0014806	Process	Smooth muscle hyperplasia	TAS	18289072
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3345742
GO:0016236	Process	Macroautophagy	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016242	Process	Negative regulation of macroautophagy	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019899	Function	Enzyme binding	ISS	15516695
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IDA	17915953
GO:0032722	Process	Positive regulation of chemokine production	TAS	17652371
GO:0034101	Process	Erythrocyte homeostasis	IMP	9884342
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS	9884342
GO:0034605	Process	Cellular response to heat	IMP	21597468
GO:0035094	Process	Response to nicotine	IDA	18205746
GO:0035556	Process	Intracellular signal transduction	TAS	17652371
GO:0042167	Process	Heme catabolic process	IBA
GO:0042167	Process	Heme catabolic process	IDA	17915953
GO:0042167	Process	Heme catabolic process	IEA
GO:0042168	Process	Heme metabolic process	IEA
GO:0042542	Process	Response to hydrogen peroxide	ISS
GO:0042802	Function	Identical protein binding	IPI	19556236
GO:0042803	Function	Protein homodimerization activity	IDA	19556236
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0045765	Process	Regulation of angiogenesis	TAS	17652371
GO:0045766	Process	Positive regulation of angiogenesis	IDA	21788589
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22503972
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	17600318
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	17600318
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IMP	9884342
GO:0071243	Process	Cellular response to arsenic-containing substance	IEA
GO:0071276	Process	Cellular response to cadmium ion	IEA
GO:0072719	Process	Cellular response to cisplatin	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IGI	24844779
GO:0110076	Process	Negative regulation of ferroptosis	IMP	26403645
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	18202225
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	24844779
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
141250	5013	ENSG00000100292

Protein

UniProt ID

P09601

Protein name

Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]

Protein function

[Heme oxygenase 1]: Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron (PubMed:11121422, Pu

PDB

1N3U , 1N45 , 1NI6 , 1OYK , 1OYL , 1OZE , 1OZL , 1OZR , 1OZW , 1S13 , 1S8C , 1T5P , 1TWN , 1TWR , 1XJZ , 1XK0 , 1XK1 , 1XK2 , 1XK3 , 3CZY , 3HOK , 3K4F , 3TGM , 4WD4 , 5BTQ , 6EHA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01126	Heme_oxygenase	11 → 216	Heme oxygenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level). {ECO:0000269|PubMed:20855888}.

Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Sequence length

288

Interactions

View interactions

	KEGG		Reactome
	Porphyrin metabolism Metabolic pathways HIF-1 signaling pathway Ferroptosis Mineral absorption Pathways in cancer MicroRNAs in cancer Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Heme degradation Interleukin-4 and Interleukin-13 signaling Iron uptake and transport Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cystic Fibrosis	cystic fibrosis	N/A	N/A	GenCC

Show/Hide Text Mining Associations (366)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Chest Syndrome	Associate	22966170
Acute Coronary Syndrome	Associate	25612606
Acute Disease	Associate	36193742, 39809189
Acute Kidney Injury	Associate	25751573, 31120979
Acute Lung Injury	Associate	19526221
Adenocarcinoma	Associate	36035281
Adenocarcinoma of Lung	Associate	35633885
AIDS Associated Nephropathy	Inhibit	28543773, 32910432
AIDS related Kaposi sarcoma	Associate	14726403
Airway Obstruction	Associate	26488115
Albuminuria	Associate	26512585, 28466968
Alveolar Bone Loss	Associate	33917440
Alzheimer Disease	Associate	19522732, 22549002, 30068908, 34837964, 36042609
Amyotrophic lateral sclerosis 1	Associate	9349552
Anemia Hemolytic	Associate	18805612, 30046137
Anemia hereditary spherocytic hemolytic	Associate	20106603
Anemia Sickle Cell	Associate	15031206, 17593033, 20106603, 22966170, 26206798, 26315932, 28466968, 29437594, 33116199, 34496009
Anemia Sickle Cell	Stimulate	30060095
Angina Unstable	Associate	15869055
Aortic Aneurysm Abdominal	Inhibit	39192217
Arrhythmias Cardiac	Associate	35915792
Arterial Occlusive Diseases	Inhibit	29437594
Arthritis Infectious	Associate	31120979
Arthritis Psoriatic	Inhibit	19536150
Arthritis Psoriatic	Associate	28423042
Arthritis Rheumatoid	Associate	16572448, 18050210, 33087158, 35759235
Arthritis Rheumatoid	Inhibit	18975324, 29096690
Asthma	Inhibit	18048809
Asthma	Associate	21531452, 21799075, 23893806, 35572500, 9828853
Asthma Occupational	Associate	20345975
Astrocytoma	Associate	24234335
Ataxia Telangiectasia	Stimulate	11278277
Ataxia Telangiectasia	Associate	30085341
Atherosclerosis	Inhibit	16474202, 16582079
Atherosclerosis	Associate	17008602, 17341845, 17927807, 20796278, 24434148, 25359861, 40489880
Atrial Fibrillation	Associate	18375832, 23437133, 25268359
Attention Deficit and Disruptive Behavior Disorders	Associate	34321570
Autoimmune Diseases	Associate	22578957
Behcet Syndrome	Inhibit	18234118
beta Thalassemia	Inhibit	21750082
beta Thalassemia	Associate	26377036
beta Thalassemia	Stimulate	32581238
Bone Diseases	Associate	36967561
Brain Injuries	Associate	34321570
Brain Ischemia	Associate	29991707, 34312792
Breast Neoplasms	Associate	21136273, 23347118, 24180625, 24366869, 25813625, 26041409, 30216645, 31964465, 32168943, 32485912, 33294119, 33801351, 37827129
Breast Neoplasms	Stimulate	31211507
Calcinosis	Inhibit	19423691
Calcinosis	Associate	23293173
Carcinogenesis	Associate	22490514, 28679437, 36691638
Carcinoma Basal Cell	Associate	35501667
Carcinoma Hepatocellular	Associate	22848562, 24098580, 27227932, 30057686, 31261522, 33378016, 34663301, 35866605, 36047102, 36189226, 36746728, 37008632, 37147523, 37330650, 38127054, 39795978, 9349552 View all (2 more)
Carcinoma Mucoepidermoid	Associate	31052354
Carcinoma Non Small Cell Lung	Associate	24300974, 27641735
Carcinoma Pancreatic Ductal	Associate	26675757, 29930735, 31243599, 32629871, 37653101, 39740375
Carcinoma Renal Cell	Associate	24636201, 34135317, 35396773, 35656025, 37031459, 40419510
Carcinoma Renal Cell	Inhibit	36178067
Carcinoma Squamous Cell	Associate	15365571, 35501667
Cardiomyopathies	Associate	15849452, 23437133
Cardiomyopathies	Stimulate	38172743
Cardiovascular Diseases	Associate	19389234, 25359861, 26132561, 36012132
Carotid Artery Diseases	Associate	20796278, 40489880
Cartilage Diseases	Associate	29339024
Cataract Age Related Nuclear	Associate	35910837
Cerebral Hemorrhage	Associate	35465695
Cerebral Infarction	Associate	20175935
Cerebral Intraventricular Hemorrhage	Associate	34445350
Cerebral Palsy	Associate	20175935
Chemical and Drug Induced Liver Injury	Associate	18972446, 23567851
Cholangiocarcinoma	Associate	20938215, 22514698
Cholangitis Sclerosing	Associate	29180269
Cholelithiasis	Associate	17593033
Choriocarcinoma	Associate	20667089
Chronic Kidney Disease Mineral and Bone Disorder	Associate	24762402
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	32291269
Chronic Periodontitis	Associate	25511052
Cognition Disorders	Associate	16882737, 25202977
Cognitive Dysfunction	Associate	19522732, 22549002
Colitis Ulcerative	Stimulate	15115285
Colitis Ulcerative	Associate	20509889, 28770550, 33299870, 39252247
Colorectal Neoplasms	Associate	22302482, 25122478, 25431258, 27323826, 27999449, 30736789, 31199053, 36869896
Colorectal Neoplasms	Stimulate	29074106
Communicable Diseases	Stimulate	12709585
Constriction Pathologic	Associate	26488115
Constriction Pathologic	Stimulate	33518452
Conversion Disorder	Associate	24959002, 27555763
Corneal Endothelial Cell Loss	Associate	26968795
Coronary Artery Disease	Associate	18443197, 19389234, 20175935, 20796278, 22123460, 22780915, 23293173, 23602216, 24762402, 28444966
Coronary Disease	Stimulate	15869055
Coronary Disease	Inhibit	22120665
Coronary Disease	Associate	27821168, 34980781
Coronary Restenosis	Associate	12730098, 15028349, 20796278
COVID 19	Associate	34439887, 35855804, 38129860
Crohn Disease	Associate	28770550
Cystic Fibrosis	Associate	28289476
Deafness	Associate	15849452
Death	Associate	26270345, 27405852, 34750390, 35134262
Delayed Graft Function	Associate	24959002
Delirium	Associate	34321570
Depressive Disorder	Associate	26824276
Dermatomyositis	Stimulate	15899048
Diabetes Complications	Associate	35806251
Diabetes Mellitus	Associate	15849452, 17991645, 18443197, 20796278, 22445099, 23293173, 26173399, 27274779, 37002266, 37414746
Diabetes Mellitus Type 1	Stimulate	34682638
Diabetes Mellitus Type 2	Associate	17991645, 18229449, 25511473, 26512585, 27374075, 29752628, 37445792
Diabetes Mellitus Type 2	Stimulate	34682638
Diabetic Nephropathies	Associate	31467925, 36401196
Diabetic Retinopathy	Associate	36689408, 38084838
Drug Related Side Effects and Adverse Reactions	Associate	10952020, 23350672, 25459138, 26041409, 26238954, 26930712, 31251786, 32968051, 34448104, 38179774, 9920842
Drug Related Side Effects and Adverse Reactions	Inhibit	32168943, 34312792
Dyslipidemias	Associate	20175935
Edema	Stimulate	27487831
Emphysema	Associate	10631150
Encephalitis	Associate	29510721
Encephalomyelitis Autoimmune Experimental	Associate	26868429
Endometrial Neoplasms	Associate	11872213
Endometrial Stromal Tumors	Associate	37773689
Endometriosis	Associate	25772769, 33800989, 37555920, 38012607
Epilepsy	Associate	37946105
Epilepsy Temporal Lobe	Associate	37946105
Esophageal Neoplasms	Associate	23919806
Esophageal Squamous Cell Carcinoma	Associate	23919806, 34264023, 34999996, 36921563, 37312528
Essential Hypertension	Associate	19886851
Essential Tremor	Associate	26091465
Feeding and Eating Disorders	Associate	24485305
Fever	Associate	30745843
Fibrosis	Associate	25268359, 26238954, 34530349, 37240308
Gastritis	Stimulate	15115285
Gastroparesis	Inhibit	29052298
Gilbert Disease	Associate	28389660
Glioblastoma	Associate	10349844, 27354342, 28365151, 31282108, 36054818, 37382594
Glioma	Associate	17216339, 24234335, 29938581, 36164395, 40495644
Glomerulonephritis IGA	Associate	19194559
Glomerulonephritis IGA	Inhibit	29137483
Glomerulosclerosis Focal Segmental	Associate	29137483
Graft vs Host Disease	Associate	27606430
Hashimoto Disease	Stimulate	32098821
Haspeslagh Fryns Muelenaere syndrome	Inhibit	23792437
Heart Defects Congenital	Stimulate	14587309
Heart Defects Congenital	Associate	35035663
Heart Diseases	Associate	14587309, 26968795, 27251503, 28186648, 37499888, 38172743
Heart Diseases	Stimulate	31731058
Heart Failure	Associate	37499888
Helicobacter Infections	Associate	35268019
Hemolysis	Associate	21106538, 23100518, 29437594, 30046137
Hemolytic Uremic Syndrome	Associate	20106603
Hemophilia A	Associate	23716558
Hemorrhage	Associate	21868703, 22052915, 27251503
Hepatitis C Chronic	Associate	24752012
Hereditary leiomyomatosis and renal cell cancer	Associate	31963199
HIV Infections	Associate	22048453, 23665328, 25202977, 28543773, 29510721, 32277015, 32910432
HIV Infections	Stimulate	24752012
HIV Infections	Inhibit	32098821
Hodgkin Disease	Associate	33738869
HTLV I Infections	Associate	23665328
Hyperbilirubinemia	Associate	27557546
Hyperbilirubinemia Neonatal	Associate	27557546, 30298137, 38279097
Hyperferritinemia	Associate	15899048
Hyperglycemia	Associate	19924377
Hypertension	Associate	35697922
Hypertension Portal	Associate	12166345
Hypertension Pregnancy Induced	Associate	34933382, 39503530
Hypertriglyceridemia	Associate	25933176
Hypertrophy Left Ventricular	Associate	15849452
hypoglycemic encephalopathy	Associate	11707454
Hypoxia	Stimulate	14615405, 16787441, 20197421, 33491566, 35417854, 36775962
Hypoxia	Associate	15211754, 16198853, 23455892, 24063008, 24114211, 35409364, 35833819, 37481543
Hypoxia	Inhibit	20118244
Hypoxia Brain	Inhibit	20118244
Hypoxia Brain	Associate	29155886
Hypoxia Brain	Stimulate	36775962
Idiopathic Pulmonary Fibrosis	Inhibit	18216050
Infarction	Associate	16198853
Infections	Associate	25198707, 31231394
Infections	Inhibit	40495644
Infertility Male	Associate	21556890
Inflammation	Associate	10491455, 11429414, 12709585, 15028349, 15115285, 15504750, 16297158, 16572448, 16620829, 17235328, 17265482, 17341845, 18202320, 18975324, 20127796 View all (48 more)
Inflammation	Inhibit	16198853, 16582079, 17927807, 18234118, 19194559, 20345481, 20509889, 22617388, 22959128, 23051580, 23455892, 25459138, 26792743, 28423042, 29170479 View all (8 more)
Inflammation	Stimulate	39287687
Inflammatory Bowel Diseases	Associate	11076874, 28770550
Insulin Resistance	Associate	35806251, 37883387
Intervertebral Disc Degeneration	Associate	26877238, 32015215, 36814575
Intracranial Hemorrhage Traumatic	Associate	34312792
Iron Deficiencies	Associate	19384939
Iron Overload	Associate	34530349, 37726294
Ischemia	Associate	15084179
Joint Diseases	Associate	18975324
Keratoconus	Associate	36240204
Kidney Calculi	Associate	36907445
Kidney Diseases	Stimulate	17258074, 18229449
Kidney Diseases	Associate	19194559, 24762402, 26512585
Kidney Failure Chronic	Associate	24762402, 26206798
Kidney Neoplasms	Associate	20855888, 21808062, 22843690, 23752066, 37898101
Laryngeal Neoplasms	Associate	27840932
Latent Tuberculosis	Associate	23671613, 26268658
Leiomyoma	Associate	36749068
Leprosy	Associate	35552484
Leukemia	Associate	17018862, 18024796, 20345481, 26870816, 27447561, 31231394, 33092263
Leukemia Lymphocytic Chronic B Cell	Associate	20368435, 27829220, 29367434
Leukemia Lymphoma Adult T Cell	Associate	31251786
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	17018862, 18024796, 24681707, 25802333
Leukemia Myeloid Acute	Associate	18202225, 20345481, 21307400, 26218201, 27606430, 36890092
Leydig Cell Tumor	Associate	38387140
Liver Cirrhosis	Associate	12166345, 16489673, 33333908
Liver Cirrhosis Alcoholic	Associate	35134262
Liver Diseases	Associate	18972446
Liver Failure	Associate	30057686, 38127054
Lung Diseases	Associate	23671613, 28289476
Lung Diseases Interstitial	Associate	18216050
Lung Injury	Associate	16882737, 21902835, 26045831
Lung Neoplasms	Stimulate	18508827
Lung Neoplasms	Associate	24012673, 31227482, 32855269, 35898682, 37749553
Lupus Erythematosus Systemic	Associate	31921135
Lupus Nephritis	Associate	31921135
Lymphatic Metastasis	Associate	18492619, 25063314
Lymphatic Metastasis	Inhibit	22490514, 34264023
Lymphohistiocytosis Hemophagocytic	Stimulate	15899048
Lymphoma	Associate	29504848, 31231394
Macrophage Activation Syndrome	Stimulate	23665328
Macular Degeneration	Associate	21647550
Malaria	Associate	20106603, 22290142, 23100518, 29742871
Malaria Cerebral	Associate	20585394, 30060095
Mastocytosis Systemic	Associate	17420286
Melanoma	Associate	11011118, 20580464, 20667089, 21910007, 37176114, 9354392
Melanoma	Stimulate	22872370
Metabolic Diseases	Associate	25933176
Metabolic Syndrome	Associate	25933176
Metabolic Syndrome	Stimulate	38069389
Mitochondrial Diseases	Associate	19625608, 21910007, 26404762, 27322610, 28720798, 29938581, 30057686, 35268019, 36565570, 37726294
Mouth Neoplasms	Associate	34769290
Mucocutaneous Lymph Node Syndrome	Stimulate	12709585
Multiple Myeloma	Associate	15725085, 22617388, 25341809, 26700310, 26795735, 26930712, 32298237, 36775962
Multiple Sclerosis	Associate	26868429, 30298137, 36595760
Muscular Dystrophy Duchenne	Associate	36565681
Mycoplasma Infections	Associate	34375508
Myelodysplastic Syndromes	Associate	27311589
Myocardial Infarction	Associate	19389234, 20175935, 23293173, 31731058, 37798364, 38253721
Myocardial Ischemia	Associate	16198853, 34750390
Myocardial Stunning	Associate	16198853, 25459138
Myopathies Structural Congenital	Associate	36869896
Myopathy Central Core	Associate	23293173
Myopathy with Giant Abnormal Mitochondria	Stimulate	30341816
Myopathy with Giant Abnormal Mitochondria	Associate	36525817
Myotoxicity	Associate	32008037
Nasopharyngeal Carcinoma	Associate	18582367, 33589574, 35682782
Necrosis	Associate	31767834
Neoplasm Invasiveness	Associate	31261522
Neoplasm Invasiveness	Stimulate	37312528
Neoplasm Metastasis	Associate	20667089, 21808062, 22490514, 24180625, 25063314, 25431258, 25661467, 31261522, 37312528
Neoplasm Metastasis	Inhibit	27999449
Neoplasms	Stimulate	16906285, 25063314, 31964465, 32485912
Neoplasms	Associate	16950787, 17216339, 18582367, 20667089, 21136273, 21911919, 22302482, 22490514, 22843690, 22848562, 23868099, 24234335, 24247298, 24380881, 24633012 View all (31 more)
Neoplasms	Inhibit	24434148, 26675757
Neoplastic Syndromes Hereditary	Associate	31963199
Nerve Degeneration	Associate	35833819, 36971687
Nervous System Diseases	Associate	21366594
Neuroblastoma	Associate	24380881, 27023064, 9354392
Neurocognitive Disorders	Associate	28543773, 29510721, 32277015, 32910432
Neurodegenerative Diseases	Associate	10681514, 25202977
Neuroinflammatory Diseases	Associate	32277015, 32910432, 36523959, 37922650
Neurotoxicity Syndromes	Associate	22549002, 28543773, 28790819
Neutropenia	Associate	33498175
Neutrophil Actin Dysfunction	Associate	23100518
Neutrophil Immunodeficiency Syndrome	Associate	23100518
Obesity	Associate	21947364, 27274779, 30024897
Obesity Maternal	Associate	18307065
Odontoma	Associate	23293173
Oligodendroglioma	Associate	24234335
Optic Neuropathy Ischemic	Associate	15725085
Osteoarthritis	Associate	23840483, 28237856, 29339024
Osteoglophonic dwarfism	Inhibit	33355373
Osteoporosis	Associate	19853072, 19924377, 40517505
Osteoporotic Fractures	Stimulate	36755691
Osteosarcoma	Associate	26283888, 32930133, 33453607, 33917440, 37285835
Ovarian Neoplasms	Associate	39210460
Pancreatic Neoplasms	Associate	30057678, 35915609, 36497150
Pancreatitis	Associate	36671463
Parathyroid Neoplasms	Associate	24681779
Parkinson Disease	Associate	26091465, 35802825
Parkinson Disease Secondary	Associate	21366594
Periodontal Diseases	Associate	25511052
Periodontitis	Associate	33917440
Peripheral Vascular Diseases	Associate	20175935
Philadelphia Chromosome	Associate	24681707
Plaque Atherosclerotic	Associate	20533393, 22123460
Pneumocystis Infections	Inhibit	33128253
Pneumonia	Associate	16582079
Pneumothorax	Associate	20526373
Polycystic Ovary Syndrome	Associate	31772710, 37883387
Polymyositis	Stimulate	15899048
Post Infectious Disorders	Associate	17927807
Postoperative Hemorrhage	Associate	27257045
Pre Eclampsia	Inhibit	10952020
Pre Eclampsia	Stimulate	18307065
Pre Eclampsia	Associate	22791762, 31964423, 33725925
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27447561
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24681707
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21911919, 26991755
Preeclamptic toxemia	Associate	22791762, 34933382
Preeclamptic toxemia	Inhibit	37702083
Progeria	Associate	28229933
Prostatic Hyperplasia	Associate	8650873
Prostatic Neoplasms	Associate	18026199, 23591596, 32640729, 32930133, 34375508
Prostatitis	Associate	18026199, 37240308
Protoporphyria Erythropoietic	Associate	27257045
Psoriasis	Associate	29980703
Pulmonary Disease Chronic Obstructive	Inhibit	12797490, 28588027, 32000766
Pulmonary Disease Chronic Obstructive	Associate	16882737, 26674585, 30341816, 31411335, 31564855, 32321531, 35441963
Pulmonary Disease Chronic Obstructive	Stimulate	27555763
Pulmonary Embolism	Associate	26337933, 37821869
Pulmonary Emphysema	Associate	10631150, 12730098
Pulmonary Fibrosis	Associate	36565570
Renal hypouricemia	Associate	31771519
Renal Insufficiency	Associate	18229449
Renal Insufficiency Chronic	Associate	15084179, 26206798, 32354559
Renal Tubular Transport Inborn Errors	Associate	37373300
Reperfusion Injury	Associate	15996234, 26840539, 28334711, 31299184, 32696819, 38172743
Respiratory Distress Syndrome	Associate	19526221
Respiratory Insufficiency	Associate	26488115
Restless Legs Syndrome	Associate	26313808
Rhinitis Allergic	Associate	36127783
Ring Chromosome 20 Syndrome	Associate	28790819
Ring Chromosome 20 Syndrome	Inhibit	33355373
Sarcoma Kaposi	Associate	14726403
Scleroderma Systemic	Stimulate	29991707
Seizures	Associate	38166692
Severe Acute Respiratory Syndrome	Associate	30060095
Sickle Cell Trait	Associate	34496009, 37533140
Sjogren's Syndrome	Associate	29504848
Sleep Apnea Obstructive	Inhibit	30159112
Smooth Muscle Tumor	Associate	37415103
Soft Tissue Injuries	Associate	12709585, 14587309, 15084179, 18307065, 28770550
Spinal Cord Injuries	Associate	33863336, 35775321
Spondylitis Ankylosing	Associate	35784335
Squamous Cell Carcinoma of Head and Neck	Associate	15365571, 27840932
Squamous Cell Carcinoma of Head and Neck	Stimulate	18492619
Squamous Cell Carcinoma of Head and Neck	Inhibit	35682782
Status Asthmaticus	Associate	22966170, 23893806, 9828853
Still's Disease Adult Onset	Associate	15899048
Stomach Neoplasms	Associate	22490514, 25956277, 28679437, 31151932, 35237380, 35417854
Stroke	Associate	20175935
Subarachnoid Hemorrhage	Associate	34312792
Tay Sachs Disease AB Variant	Associate	37715818
Thrombosis	Associate	18201862
Thyroid cancer follicular	Associate	36691638
Tongue Neoplasms	Associate	35806120
Tricuspid Valve Insufficiency	Associate	26337933
Triple Negative Breast Neoplasms	Associate	37664913, 38012585
Tuberculosis	Associate	23671613, 26268658, 32098821
Tuberculosis Extrapulmonary	Associate	23671613
Tuberculosis Meningeal	Associate	25198707
Tuberculosis Pulmonary	Associate	23671613
Urinary Bladder Neoplasms	Associate	25063314, 36584429
Uterine Cervical Neoplasms	Associate	30745843, 38031977
Uterine Diseases	Associate	33678318, 37773689
Vascular Diseases	Associate	17823375, 26968795, 31230554, 38069389
Vascular Remodeling	Associate	37499888
Vasospasm Intracranial	Associate	34312792
Venous Thromboembolism	Associate	18201862, 22959128
Ventricular Dysfunction Left	Associate	33410147
Ventricular Remodeling	Inhibit	16198853
Vitiligo	Associate	21426408, 24662764, 25029322, 27222475, 29974998
Vitreoretinopathy Proliferative	Stimulate	38180775
von Hippel Lindau Disease	Associate	34135317
Wounds and Injuries	Associate	22698995, 34321570, 37773689, 9828853
Zika Virus Infection	Associate	30577437

HMOX1 (heme oxygenase 1)