Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3159
Gene name Gene Name - the full gene name approved by the HGNC.
High mobility group AT-hook 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HMGA1
Synonyms (NCBI Gene) Gene synonyms aliases
HMG-R, HMGA1A, HMGIY
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000349 hsa-miR-125b-5p Luciferase reporter assay 17563749
MIRT000110 hsa-miR-26a-5p Luciferase reporter assay 17563749
MIRT003152 hsa-let-7a-5p Luciferase reporter assay, qRT-PCR 19179606
MIRT003152 hsa-let-7a-5p Luciferase reporter assay, qRT-PCR 19179606
MIRT001625 hsa-let-7b-5p pSILAC 18668040
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 22389255
MYCN Unknown 16166307
SP1 Activation 17510387
SP1 Unknown 22389255
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 9253416
GO:0003677 Function DNA binding ISS
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding IDA 9253416
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding ISS
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding TAS 10428834
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600701 5010 ENSG00000137309
Protein
UniProt ID P17096
Protein name High mobility group protein HMG-I/HMG-Y (HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1) (High mobility group protein R)
Protein function HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the
PDB 2EZD , 2EZE , 2EZF , 2EZG , 8CPG
Family and domains
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Sequence length 107
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Integration of provirus
2-LTR circle formation
Integration of viral DNA into host genomic DNA
Autointegration results in viral DNA circles
APOBEC3G mediated resistance to HIV-1 infection
Vpr-mediated nuclear import of PICs
Formation of Senescence-Associated Heterochromatin Foci (SAHF)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
23512162
Metabolic syndrome Metabolic Syndrome X rs367643250, rs587777380, rs777736953 23512162
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
20347905
Unknown
Disease term Disease name Evidence References Source
Diabetes Mellitus type 2 diabetes mellitus GenCC
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Atrial Fibrillation Atrial Fibrillation GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27027341
Adenocarcinoma Associate 27484584
Adenocarcinoma Follicular Stimulate 10714095
Adenocarcinoma of Lung Stimulate 24564251
Adenocarcinoma of Lung Associate 27025651, 28000891, 30353687, 33684161, 35805937
Adenoma Stimulate 30999005
Alzheimer Disease Associate 17903177, 20194618
Brain Neoplasms Associate 31116627
Breast Neoplasms Associate 17290307, 22932725, 23658826, 25572132, 25755724, 26265440, 26527623, 27723831, 28924209, 31167352, 31531802, 35504904, 36614035
Calcinosis Cutis Associate 23658826