Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3134
Gene name	Major histocompatibility complex, class I, F
Gene symbol	HLA-F
Synonyms (NCBI Gene)	CDA12HLA-5.4HLA-CDA12HLAF
Chromosome	6
Chromosome location	6p22.1
Summary	This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this m

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438041	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438038	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438041	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438038	hsa-miR-93-5p	qRT-PCR	24367666
MIRT1048556	hsa-miR-130a	CLIP-seq
MIRT1048557	hsa-miR-130b	CLIP-seq
MIRT1048558	hsa-miR-1827	CLIP-seq
MIRT1048559	hsa-miR-221	CLIP-seq
MIRT1048560	hsa-miR-222	CLIP-seq
MIRT1048561	hsa-miR-301a	CLIP-seq
MIRT1048562	hsa-miR-301b	CLIP-seq
MIRT1048563	hsa-miR-3666	CLIP-seq
MIRT1048564	hsa-miR-4295	CLIP-seq
MIRT1048565	hsa-miR-4316	CLIP-seq
MIRT1048566	hsa-miR-454	CLIP-seq
MIRT1048567	hsa-miR-519a	CLIP-seq
MIRT1048568	hsa-miR-519b-3p	CLIP-seq
MIRT1048569	hsa-miR-519c-3p	CLIP-seq
MIRT1048570	hsa-miR-548v	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
CIITA	Unknown	11137213
HIVEP2	Unknown	1409593
MYC	Activation	8206526
MYCN	Unknown	8895520
NFKB1	Unknown	11137213;9725221
RELA	Unknown	11137213

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	16709803
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IMP	23851683
GO:0002376	Process	Immune system process	IEA
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IDA	28636952
GO:0002477	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class Ib	IDA	23851683
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0002725	Process	Negative regulation of T cell cytokine production	IDA	24018270
GO:0002728	Process	Negative regulation of natural killer cell cytokine production	IDA	24018270
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IDA	27455421
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	10605026, 11169396, 20483783, 24018270, 27455421, 27649529, 28636952, 33961781
GO:0005615	Component	Extracellular space	IBA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	23851683
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	10605026
GO:0005886	Component	Plasma membrane	IDA	16709803, 23851683, 27455421
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	20865824
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0030881	Function	Beta-2-microglobulin binding	IDA	28636952
GO:0031901	Component	Early endosome membrane	IDA	23851683
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032398	Component	MHC class Ib protein complex	IDA	28636952
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	23851683, 28636952
GO:0042612	Component	MHC class I protein complex	IEA
GO:0043322	Process	Negative regulation of natural killer cell degranulation	IDA	24018270
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IDA	27455421
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	24018270
GO:0046978	Function	TAP1 binding	IPI	10605026
GO:0046979	Function	TAP2 binding	IPI	10605026
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055038	Component	Recycling endosome membrane	TAS
GO:0071889	Function	14-3-3 protein binding	IDA	16709803
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IEA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
143110	4963	ENSG00000204642

P30511

Protein name

HLA class I histocompatibility antigen, alpha chain F (CDA12) (HLA F antigen) (Leukocyte antigen F) (MHC class I antigen F)

Protein function

Non-classical major histocompatibility class Ib molecule postulated to play a role in immune surveillance, immune tolerance and inflammation. Functions in two forms, as a heterotrimeric complex with B2M/beta-2 microglobulin and a peptide (peptid

PDB

5IUE , 5KNM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00129	MHC_I	22 → 200	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
PF07654	C1-set	208 → 287	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in resting B cells (at protein level). Expressed in secondary lymphoid organs rich in B and T cells such as the tonsils, spleen, and thymus (at protein level) (PubMed:10605026, PubMed:11169396). Expressed in the endothelial c

Sequence

MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV

Sequence length

346

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Phagosome Cellular senescence Cell adhesion molecules Antigen processing and presentation Type I diabetes mellitus Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Viral carcinogenesis Autoimmune thyroid disease Allograft rejection Graft-versus-host disease Viral myocarditis		ER-Phagosome pathway Endosomal/Vacuolar pathway Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Interferon gamma signaling Interferon alpha/beta signaling Antigen Presentation: Folding, assembly and peptide loading of class I MHC

HLA-F (major histocompatibility complex, class I, F)