HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)

Gene

• Entrez ID: 3125
• Gene name: Major histocompatibility complex, class II, DR beta 3
• Gene symbol: HLA-DRB3
• Synonyms (NCBI Gene): DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
• Chromosome: 6
• Chromosome location: 6p21.3
• Summary: HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides der

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT1048467	hsa-miR-4793-5p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq
MIRT2011021	hsa-miR-298	CLIP-seq
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT2011022	hsa-miR-4731-5p	CLIP-seq
MIRT2011023	hsa-miR-486-3p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq
MIRT2011021	hsa-miR-298	CLIP-seq
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT2243304	hsa-miR-4699-5p	CLIP-seq
MIRT2011022	hsa-miR-4731-5p	CLIP-seq
MIRT2011023	hsa-miR-486-3p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Unknown	10886240
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002469	Process	Myeloid dendritic cell antigen processing and presentation	IDA	19531622, 30282837
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0002842	Process	Positive regulation of T cell mediated immune response to tumor cell	IDA	30282837
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	18305173
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	19531622
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	6414998
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	NAS	8775462
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	19531622, 32341563
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IDA	18305173
GO:0031902	Component	Late endosome membrane	IEA
GO:0032395	Function	MHC class II receptor activity	NAS	6414998
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	17583734, 18697946
GO:0042605	Function	Peptide antigen binding	ISS	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	ISS	20356827
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:0120281	Component	Autolysosome membrane	IEA
GO:2000516	Process	Positive regulation of CD4-positive, alpha-beta T cell activation	IDA	19531622

Other IDs

• MIM: 612735
• HGNC: 4951
• e!Ensembl: HGNC

Protein

• UniProt ID: P79483
• Protein name: HLA class II histocompatibility antigen, DR beta 3 chain (MHC class II antigen DRB3)
• Protein function: A beta chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the alpha chain HLA-DRA, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T c
• PDB: 2Q6W, 3C5J, 4H1L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00969	MHC_II_beta	42 → 116	Class II histocompatibility antigen, beta domain	Domain
  PF07654	C1-set	128 → 209	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in professional APCs: monocyte/macrophages, dendritic cells and B cells (at protein level). {ECO:0000269|PubMed:19531622, ECO:0000269|PubMed:19830726}.
• Sequence:

  MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
  HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
  QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
  DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
  FLGAGLFIYFRNQKGHSGLQPTGFLS

• Sequence length: 266

Pathways

KEGG:

Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
MHC class II antigen presentation
PD-1 signaling
Interferon gamma signaling