Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3123
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DR beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DRB1
Synonyms (NCBI Gene) Gene synonyms aliases	DRB1, HLA-DR1B, HLA-DRB, SS1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derive

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646417	hsa-miR-5692a	HITS-CLIP	23824327
MIRT646416	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT646415	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT646414	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT646413	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646412	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT646411	hsa-miR-3148	HITS-CLIP	23824327
MIRT646410	hsa-miR-6124	HITS-CLIP	23824327
MIRT646409	hsa-miR-5696	HITS-CLIP	23824327
MIRT646408	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT646407	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT646406	hsa-miR-623	HITS-CLIP	23824327
MIRT646405	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646404	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646403	hsa-miR-3978	HITS-CLIP	23824327
MIRT646402	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646401	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT646400	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT646417	hsa-miR-5692a	HITS-CLIP	23824327
MIRT646416	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT646415	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT646414	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT646413	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646412	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT646411	hsa-miR-3148	HITS-CLIP	23824327
MIRT646410	hsa-miR-6124	HITS-CLIP	23824327
MIRT646409	hsa-miR-5696	HITS-CLIP	23824327
MIRT646408	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT646407	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT646406	hsa-miR-623	HITS-CLIP	23824327
MIRT646405	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646404	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646403	hsa-miR-3978	HITS-CLIP	23824327
MIRT646402	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646401	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT646400	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1048458	hsa-miR-4793-5p	CLIP-seq
MIRT1048459	hsa-miR-518a-5p	CLIP-seq
MIRT1048460	hsa-miR-527	CLIP-seq
MIRT2243303	hsa-miR-486-3p	CLIP-seq
MIRT1048459	hsa-miR-518a-5p	CLIP-seq
MIRT1048460	hsa-miR-527	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CIITA	Unknown	10886240
ILF3	Unknown	7651394
RFX5	Unknown	11258423;18723135
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423;18723135
VDR	Unknown	19956544

Show/Hide all(96)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001772	Component	Immunological synapse	IDA	15322540, 29884618
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	29884618
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002437	Process	Inflammatory response to antigenic stimulus	IDA	15795121
GO:0002469	Process	Myeloid dendritic cell antigen processing and presentation	IDA	29884618, 30282837
GO:0002491	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class II	IDA	15322540
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IDA	1448172, 7606781, 22733780
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0002842	Process	Positive regulation of T cell mediated immune response to tumor cell	IDA	30282837
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IDA	18039812
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	1281771
GO:0005515	Function	Protein binding	IPI	9354468, 21081917, 27114505
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	9075930, 18305173
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005882	Component	Intermediate filament	TAS	1281771
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3456344, 10425186
GO:0006955	Process	Immune response	IDA	20543955, 21569485
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IMP	22321387
GO:0006955	Process	Immune response	NAS	3129499
GO:0006955	Process	Immune response	TAS	10609818
GO:0006959	Process	Humoral immune response	IMP	17050030
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007165	Process	Signal transduction	IMP	15795121
GO:0007165	Process	Signal transduction	NAS	8775462
GO:0008544	Process	Epidermis development	TAS	7539673
GO:0009897	Component	External side of plasma membrane	IDA	20543955
GO:0009986	Component	Cell surface	IDA	21502329
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	3129499
GO:0016020	Component	Membrane	TAS	11144299
GO:0016045	Process	Detection of bacterium	IMP	22321387
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	15265931, 32341563
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0030247	Function	Polysaccharide binding	IDA	21502329
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IDA	9075930, 18305173
GO:0031902	Component	Late endosome membrane	IEA
GO:0032395	Function	MHC class II receptor activity	IDA	15795121
GO:0032395	Function	MHC class II receptor activity	NAS	3129499
GO:0032395	Function	MHC class II receptor activity	TAS	3456344, 10425186, 11144299
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032653	Process	Regulation of interleukin-10 production	IDA	20543955
GO:0032673	Process	Regulation of interleukin-4 production	IDA	20543955
GO:0032689	Process	Negative regulation of type II interferon production	IMP	15795121
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IDA	28467828
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	21484216
GO:0042088	Process	T-helper 1 type immune response	IMP	15795121
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	15795121
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	1448172, 7477400, 7606781, 20543955, 21502329, 22733780
GO:0042608	Function	T cell receptor binding	IDA	29884618
GO:0042609	Function	CD4 receptor binding	IPI	24942581
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	1448172, 7477400, 7606781, 21502329, 22733780
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	IMP	9354468
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24942581
GO:0043382	Process	Positive regulation of memory T cell differentiation	IDA	27591323
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0045622	Process	Regulation of T-helper cell differentiation	IDA	15322540
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24942581
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0051262	Process	Protein tetramerization	IDA	20543955
GO:0070062	Component	Extracellular exosome	HDA	12519789, 19199708, 20458337
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	24942581
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:0120281	Component	Autolysosome membrane	IEA
GO:2000516	Process	Positive regulation of CD4-positive, alpha-beta T cell activation	IDA	15265931

MIM	HGNC	e!Ensembl
142857	4948	ENSG00000196126

Protein

UniProt ID

P01911

Protein name

HLA class II histocompatibility antigen, DRB1 beta chain (Human leukocyte antigen DRB1) (HLA-DRB1)

Protein function

A beta chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the alpha chain HLA-DRA, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T c

PDB

1A6A , 1AQD , 1BX2 , 1D5M , 1D5X , 1D5Z , 1D6E , 1DLH , 1FYT , 1HXY , 1J8H , 1JWM , 1JWS , 1JWU , 1KG0 , 1KLG , 1KLU , 1LO5 , 1PYW , 1R5I , 1SEB , 1SJE , 1SJH , 1T5W , 1T5X , 1YMM , 2FSE , 2G9H , 2IAM , 2IAN , 2ICW , 2IPK , 2OJE , 2SEB , 2WBJ , 2XN9 , 3L6F , 3O6F , 3PDO , 3PGC , 3PGD , 3QXA , 3QXD , 3S4S , 3S5L , 3T0E , 4AEN , 4AH2 , 4C56 , 4E41 , 4FQX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00969	MHC_II_beta	42 → 116	Class II histocompatibility antigen, beta domain	Domain
PF07654	C1-set	128 → 209	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in professional APCs: monocyte/macrophages, dendritic cells and B cells (at protein level) (PubMed:19830726, PubMed:23783831, PubMed:31495665). Expressed in thymic epithelial cells (at protein level) (PubMed:23783831). {ECO:0

Sequence

MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF
YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS

Sequence length

266

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Systemic lupus erythematosus	systemic lupus erythematosus	N/A	N/A	GenCC

HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)