Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3122
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DR alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DRA
Synonyms (NCBI Gene) Gene synonyms aliases	HLA-DRA1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. This molecule is expressed on the surface of various antigen presenting cells such a

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT401743	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT392159	hsa-miR-4496	PAR-CLIP	23592263
MIRT401741	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT401739	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT401744	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT487344	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487343	hsa-miR-124-5p	PAR-CLIP	23592263
MIRT401738	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT401740	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT401745	hsa-miR-3915	PAR-CLIP	23592263
MIRT487342	hsa-miR-1224-5p	PAR-CLIP	23592263
MIRT487341	hsa-miR-4689	PAR-CLIP	23592263
MIRT487340	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT487339	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT401743	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT392159	hsa-miR-4496	PAR-CLIP	23592263
MIRT401741	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT401739	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT401744	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT487344	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487343	hsa-miR-124-5p	PAR-CLIP	23592263
MIRT401738	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT401740	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT401745	hsa-miR-3915	PAR-CLIP	23592263
MIRT487342	hsa-miR-1224-5p	PAR-CLIP	23592263
MIRT487341	hsa-miR-4689	PAR-CLIP	23592263
MIRT487340	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT487339	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT1048447	hsa-miR-3148	CLIP-seq
MIRT1048448	hsa-miR-3158-3p	CLIP-seq
MIRT1048449	hsa-miR-3652	CLIP-seq
MIRT1048450	hsa-miR-4430	CLIP-seq
MIRT1048451	hsa-miR-4446-3p	CLIP-seq
MIRT1048452	hsa-miR-4492	CLIP-seq
MIRT1048453	hsa-miR-4498	CLIP-seq
MIRT1048454	hsa-miR-4699-5p	CLIP-seq
MIRT1048455	hsa-miR-4728-3p	CLIP-seq
MIRT1048456	hsa-miR-762	CLIP-seq
MIRT1048457	hsa-miR-875-3p	CLIP-seq
MIRT2682322	hsa-miR-298	CLIP-seq
MIRT2682323	hsa-miR-4422	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
CIITA	Activation	9600954
CIITA	Unknown	10886240;11429551;11889043;9300692
HDAC1	Repression	11533238
ILF3	Repression	10079079
ILF3	Unknown	7651394
POU2F2	Unknown	7629508
RFX1	Unknown	11889043
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423
YY1	Unknown	11533238;19252299

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001772	Component	Immunological synapse	IDA	15322540, 29884618
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	29884618
GO:0002250	Process	Adaptive immune response	IEA
GO:0002469	Process	Myeloid dendritic cell antigen processing and presentation	IDA	29884618
GO:0002491	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class II	IDA	15322540
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IDA	1448172, 7606781, 22733780
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	21502329
GO:0005515	Function	Protein binding	IPI	9354468, 27114505
GO:0005764	Component	Lysosome	IDA	8890155
GO:0005765	Component	Lysosomal membrane	IDA	9075930, 18305173
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	8890155
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	6304715, 6812963
GO:0006955	Process	Immune response	NAS	6304715, 6812963
GO:0009986	Component	Cell surface	IDA	21502329
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016032	Process	Viral process	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	15265931
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030247	Function	Polysaccharide binding	IDA	21502329
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IDA	9075930, 18305173, 19117940
GO:0032395	Function	MHC class II receptor activity	NAS	6304715, 6812963
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IDA	28467828
GO:0042605	Function	Peptide antigen binding	IDA	1448172, 7477400, 7606781, 17583734, 18697946, 21502329, 22733780
GO:0042608	Function	T cell receptor binding	IDA	29884618
GO:0042613	Component	MHC class II protein complex	IDA	1448172, 7477400, 7606781, 21502329, 22733780
GO:0042613	Component	MHC class II protein complex	IMP	9354468
GO:0043382	Process	Positive regulation of memory T cell differentiation	IDA	27591323
GO:0045622	Process	Regulation of T-helper cell differentiation	IDA	15322540
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050890	Process	Cognition	IMP	23227193
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19056867, 19199708, 20458337
GO:0071556	Component	Integral component of lumenal side of endoplasmic reticulum membrane	TAS
GO:2000516	Process	Positive regulation of CD4-positive, alpha-beta T cell activation	IDA	15265931

MIM	HGNC	e!Ensembl
142860	4947	ENSG00000204287

Protein

UniProt ID

P01903

Protein name

HLA class II histocompatibility antigen, DR alpha chain (MHC class II antigen DRA)

Protein function

An alpha chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the beta chain HLA-DRB, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T

PDB

1A6A , 1AQD , 1BX2 , 1D5M , 1D5X , 1D5Z , 1D6E , 1DLH , 1FV1 , 1FYT , 1H15 , 1HQR , 1HXY , 1J8H , 1JWM , 1JWS , 1JWU , 1KG0 , 1KLG , 1KLU , 1LO5 , 1PYW , 1R5I , 1SEB , 1SJE , 1SJH , 1T5W , 1T5X , 1YMM , 1ZGL , 2FSE , 2G9H , 2IAM , 2IAN , 2ICW , 2IPK , 2OJE , 2Q6W , 2SEB , 2WBJ , 2XN9 , 3C5J , 3L6F , 3O6F , 3PDO , 3PGC , 3PGD , 3QXA , 3QXD , 3S4S , 3S5L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00993	MHC_II_alpha	29 → 108	Class II histocompatibility antigen, alpha domain	Domain
PF07654	C1-set	114 → 195	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in professional APCs: macrophages, dendritic cells and B cells (at protein level) (PubMed:15322540, PubMed:23783831, PubMed:31495665). Expressed in thymic epithelial cells (at protein level) (PubMed:23783831). {ECO:0000269|Pu

Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GLRKSNAAERRGPL

Sequence length

254

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	19430480, 17632545
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	17660530, 20598377
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137
Non-obstructive azoospermia	Non-obstructive azoospermia	rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900	22541561
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	20711177, 24511991
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	21156761, 17804836, 19503088

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Sarcoidosis	Sarcoidosis		22952805, 26651848, 19165924	ClinVar

HLA-DRA (major histocompatibility complex, class II, DR alpha)