Gene Gene information from NCBI Gene database.
Entrez ID 3120
Gene name Major histocompatibility complex, class II, DQ beta 2
Gene symbol HLA-DQB2
Synonyms (NCBI Gene)
DQB2HLA-DQB1HLA-DXB
Chromosome 6
Chromosome location 6p21.32
Summary HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptide
miRNA miRNA information provided by mirtarbase database.
24
miRTarBase ID miRNA Experiments Reference
MIRT030178 hsa-miR-26b-5p Microarray 19088304
MIRT444943 hsa-miR-548c-3p PAR-CLIP 22100165
MIRT444942 hsa-miR-369-5p PAR-CLIP 22100165
MIRT444941 hsa-miR-526b-5p PAR-CLIP 22100165
MIRT444943 hsa-miR-548c-3p PAR-CLIP 22100165
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
RFX5 Unknown 11258423
RFXANK Unknown 11258423
RFXAP Unknown 11258423
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002503 Process Peptide antigen assembly with MHC class II protein complex IBA
GO:0002504 Process Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615161 4945 ENSG00000232629
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P05538
Protein name HLA class II histocompatibility antigen, DQ beta 2 chain (HLA class II histocompatibility antigen, DX beta chain) (MHC class II antigen DQB2)
Protein function Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00969 MHC_II_beta 45 117 Class II histocompatibility antigen, beta domain Domain
PF07654 C1-set 130 211 Immunoglobulin C1-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Restricted to skin Langerhans cells (at protein level). {ECO:0000269|PubMed:22407913}.
Sequence
MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVA
RYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAE
LRT
TLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIR
NGDWTFQILVMLEITPQRGDIYTCQVEHPSL
QSPITVEWRAQSESAQSKMLSGIGGFVLG
LIFLGLGLIIRHRGQKGPRGPPPAGLLH
Sequence length 268
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
  Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
MHC class II antigen presentation
PD-1 signaling
Interferon gamma signaling