Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	312
Gene name Gene Name - the full gene name approved by the HGNC.	Annexin A13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANXA13
Synonyms (NCBI Gene) Gene synonyms aliases	ANX13, ISA
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet be

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments
MIRT786408	hsa-miR-1	CLIP-seq
MIRT786409	hsa-miR-105	CLIP-seq
MIRT786410	hsa-miR-1227	CLIP-seq
MIRT786411	hsa-miR-206	CLIP-seq
MIRT786412	hsa-miR-3673	CLIP-seq
MIRT786413	hsa-miR-4484	CLIP-seq
MIRT786414	hsa-miR-455-5p	CLIP-seq
MIRT786415	hsa-miR-4799-5p	CLIP-seq
MIRT786416	hsa-miR-520d-5p	CLIP-seq
MIRT786417	hsa-miR-524-5p	CLIP-seq
MIRT786418	hsa-miR-613	CLIP-seq
MIRT786419	hsa-miR-885-5p	CLIP-seq
MIRT786420	hsa-miR-1252	CLIP-seq
MIRT786421	hsa-miR-3647-3p	CLIP-seq
MIRT786422	hsa-miR-4775	CLIP-seq
MIRT786423	hsa-miR-590-3p	CLIP-seq
MIRT2475342	hsa-miR-1827	CLIP-seq
MIRT2475343	hsa-miR-3609	CLIP-seq
MIRT2475344	hsa-miR-4709-3p	CLIP-seq
MIRT2475345	hsa-miR-548ah	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IDA	27676605
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	IDA	27676605
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	27676605
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	NAS	1530946
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019898	Component	Extrinsic component of membrane	IDA	27676605
GO:0030154	Process	Cell differentiation	NAS	1530946
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1901611	Function	Phosphatidylglycerol binding	IDA	27676605

MIM	HGNC	e!Ensembl
602573	536	ENSG00000104537

Protein

UniProt ID

P27216

Protein name

Annexin A13 (Annexin XIII) (Annexin-13) (Intestine-specific annexin) (ISA)

Protein function

[Isoform A]: Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner (PubMed:27676605, PubMed:30610115). Half-maximal membrane binding requires about 60 uM calcium. Does not bind to membranes that

PDB

6B3I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	18 → 83	Annexin	Family
PF00191	Annexin	90 → 155	Annexin	Family
PF00191	Annexin	173 → 239	Annexin	Family
PF00191	Annexin	249 → 314	Annexin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in epithelial cells in colon and jejunum (at protein level). Detected in epithelial cells in jejunum. {ECO:0000269|PubMed:1530946}.

Sequence

MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATY
GKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKE
IIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD
AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLV
RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR
SDTSGDFRKLLVALLH

Sequence length

316

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Pancreatic Ductal	Associate	26644413
Carcinoma Renal Cell	Associate	37464398
Cholangiocarcinoma	Associate	26644413
Colorectal Neoplasms	Associate	28423508
Glomerulosclerosis Focal Segmental	Associate	34675284
Lupus Nephritis	Associate	26110394
Lymphatic Metastasis	Associate	28423508
Neoplasm Metastasis	Associate	28423508
Neoplasms	Associate	28423508

ANXA13 (annexin A13)