Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3119
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DQ beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DQB1
Synonyms (NCBI Gene) Gene synonyms aliases	CELIAC1, HLA-DQB, IDDM1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deriv

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048418	hsa-miR-3170	CLIP-seq
MIRT1048419	hsa-miR-3189-3p	CLIP-seq
MIRT1048420	hsa-miR-342-5p	CLIP-seq
MIRT1048421	hsa-miR-380	CLIP-seq
MIRT1048422	hsa-miR-3924	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048424	hsa-miR-4495	CLIP-seq
MIRT1048425	hsa-miR-4651	CLIP-seq
MIRT1048426	hsa-miR-4664-5p	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048428	hsa-miR-4695-3p	CLIP-seq
MIRT1048429	hsa-miR-4738-5p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq
MIRT1048431	hsa-miR-608	CLIP-seq
MIRT1048432	hsa-miR-944	CLIP-seq
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048428	hsa-miR-4695-3p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CIITA	Unknown	11332992
CREB1	Unknown	1324879
DEK	Unknown	12823858
RFX5	Unknown	11258423;18723135
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423;18723135

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	14769912, 17629515, 29997244, 33961781
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	2998758
GO:0006959	Process	Humoral immune response	IMP	17050030
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	2998758
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	32341563
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	NAS	2998758
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	ISS	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	ISS	20356827
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
604305	4944	ENSG00000179344

Protein

UniProt ID

P01920

Protein name

HLA class II histocompatibility antigen, DQ beta 1 chain (MHC class II antigen DQB1)

Protein function

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T

PDB

1JK8 , 1S9V , 1UVQ , 2NNA , 4GG6 , 4OZF , 4OZG , 4OZH , 4OZI , 8VSP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00969	MHC_II_beta	45 → 118	Class II histocompatibility antigen, beta domain	Domain
PF07654	C1-set	131 → 212	Immunoglobulin C1-set domain	Domain

Sequence

MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVT
RYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLI
RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

HLA-DQB1 (major histocompatibility complex, class II, DQ beta 1)