Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3115
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DP beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DPB1
Synonyms (NCBI Gene) Gene synonyms aliases	DPB1, HLA-DP, HLA-DP1B, HLA-DPB
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deri

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments
MIRT1048385	hsa-miR-103a	CLIP-seq
MIRT1048386	hsa-miR-107	CLIP-seq
MIRT1048387	hsa-miR-1286	CLIP-seq
MIRT1048388	hsa-miR-15a	CLIP-seq
MIRT1048389	hsa-miR-15b	CLIP-seq
MIRT1048390	hsa-miR-16	CLIP-seq
MIRT1048391	hsa-miR-195	CLIP-seq
MIRT1048392	hsa-miR-214	CLIP-seq
MIRT1048393	hsa-miR-3127-5p	CLIP-seq
MIRT1048394	hsa-miR-3185	CLIP-seq
MIRT1048395	hsa-miR-3612	CLIP-seq
MIRT1048396	hsa-miR-3619-5p	CLIP-seq
MIRT1048397	hsa-miR-3672	CLIP-seq
MIRT1048398	hsa-miR-3919	CLIP-seq
MIRT1048399	hsa-miR-3944-5p	CLIP-seq
MIRT1048400	hsa-miR-424	CLIP-seq
MIRT1048401	hsa-miR-4270	CLIP-seq
MIRT1048402	hsa-miR-4291	CLIP-seq
MIRT1048403	hsa-miR-4293	CLIP-seq
MIRT1048404	hsa-miR-4310	CLIP-seq
MIRT1048405	hsa-miR-4441	CLIP-seq
MIRT1048406	hsa-miR-4443	CLIP-seq
MIRT1048407	hsa-miR-4722-5p	CLIP-seq
MIRT1048408	hsa-miR-4756-3p	CLIP-seq
MIRT1048409	hsa-miR-4768-3p	CLIP-seq
MIRT1048410	hsa-miR-497	CLIP-seq
MIRT1048411	hsa-miR-548u	CLIP-seq
MIRT1048412	hsa-miR-650	CLIP-seq
MIRT1048413	hsa-miR-761	CLIP-seq
MIRT1048414	hsa-miR-922	CLIP-seq
MIRT2011006	hsa-miR-1200	CLIP-seq
MIRT2011007	hsa-miR-1206	CLIP-seq
MIRT2011008	hsa-miR-18a	CLIP-seq
MIRT2011009	hsa-miR-18b	CLIP-seq
MIRT2011010	hsa-miR-1911	CLIP-seq
MIRT2011011	hsa-miR-3605-5p	CLIP-seq
MIRT2011012	hsa-miR-3907	CLIP-seq
MIRT1048403	hsa-miR-4293	CLIP-seq
MIRT2011013	hsa-miR-4324	CLIP-seq
MIRT2011014	hsa-miR-4709-3p	CLIP-seq
MIRT2011015	hsa-miR-4729	CLIP-seq
MIRT2011016	hsa-miR-4735-3p	CLIP-seq
MIRT2011017	hsa-miR-4778-3p	CLIP-seq
MIRT2011018	hsa-miR-544b	CLIP-seq
MIRT2011019	hsa-miR-579	CLIP-seq
MIRT2011020	hsa-miR-617	CLIP-seq
MIRT2011008	hsa-miR-18a	CLIP-seq
MIRT2011009	hsa-miR-18b	CLIP-seq
MIRT1048395	hsa-miR-3612	CLIP-seq
MIRT1048397	hsa-miR-3672	CLIP-seq
MIRT2011012	hsa-miR-3907	CLIP-seq
MIRT2243279	hsa-miR-3910	CLIP-seq
MIRT1048406	hsa-miR-4443	CLIP-seq
MIRT2011014	hsa-miR-4709-3p	CLIP-seq
MIRT2011016	hsa-miR-4735-3p	CLIP-seq
MIRT1048412	hsa-miR-650	CLIP-seq
MIRT2389013	hsa-miR-326	CLIP-seq
MIRT2389014	hsa-miR-330-5p	CLIP-seq
MIRT2389015	hsa-miR-4777-3p	CLIP-seq
MIRT2389016	hsa-miR-875-5p	CLIP-seq
MIRT2682321	hsa-miR-520f	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CIITA	Unknown	11889043
RFX1	Unknown	11889043
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0009986	Component	Cell surface	IMP	20356827
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	32341563
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IMP	20356827
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	20356827
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	20356827
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IMP	20356827
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
142858	4940	ENSG00000223865

Protein

UniProt ID

P04440

Protein name

HLA class II histocompatibility antigen, DP beta 1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1)

Protein function

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T

PDB

3LQZ , 4P4K , 4P4R , 4P57 , 4P5K , 4P5M , 7T2A , 7T2B , 7T2C , 7T2D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00969	MHC_II_beta	42 → 114	Class II histocompatibility antigen, beta domain	Domain
PF07654	C1-set	126 → 207	Immunoglobulin C1-set domain	Domain

Sequence

MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA

Sequence length

258

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

HLA-DPB1 (major histocompatibility complex, class II, DP beta 1)