Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3113
Gene name	Major histocompatibility complex, class II, DP alpha 1
Gene symbol	HLA-DPA1
Synonyms (NCBI Gene)	DP(W3)DP(W4)DPA1HLA-DP1AHLA-DPAHLA-DPB1HLADPHLASBPLT1
Chromosome	6
Chromosome location	6p21.32
Summary	HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides de

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440497	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440497	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT1048380	hsa-miR-200b	CLIP-seq
MIRT1048381	hsa-miR-200c	CLIP-seq
MIRT1048382	hsa-miR-429	CLIP-seq
MIRT1048383	hsa-miR-4724-5p	CLIP-seq
MIRT1048384	hsa-miR-4766-5p	CLIP-seq
MIRT2243276	hsa-miR-101	CLIP-seq
MIRT2243277	hsa-miR-144	CLIP-seq
MIRT2243278	hsa-miR-582-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781, 34819669
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	2461352
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	2461352
GO:0009986	Component	Cell surface	IMP	20356827
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IMP	20356827
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	NAS	2461352
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	20356827
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	20356827
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IMP	20356827
GO:0071346	Process	Cellular response to type II interferon	IDA	8568247
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
142880	4938	ENSG00000231389

P20036

Protein name

HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)

Protein function

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T

PDB

3LQZ , 4P4K , 4P4R , 4P57 , 4P5K , 4P5M , 7T2A , 7T2B , 7T2C , 7T2D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00993	MHC_II_alpha	35 → 114	Class II histocompatibility antigen, alpha domain	Domain
PF07654	C1-set	120 → 201	Immunoglobulin C1-set domain	Domain

Sequence

MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL

Sequence length

260

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

HLA-DPA1 (major histocompatibility complex, class II, DP alpha 1)