Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3113
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DP alpha 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DPA1
Synonyms (NCBI Gene) Gene synonyms aliases	DP(W3), DP(W4), DPA1, HLA-DP1A, HLA-DPA, HLA-DPB1, HLADP, HLASB, PLT1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides de

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440497	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440497	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT1048380	hsa-miR-200b	CLIP-seq
MIRT1048381	hsa-miR-200c	CLIP-seq
MIRT1048382	hsa-miR-429	CLIP-seq
MIRT1048383	hsa-miR-4724-5p	CLIP-seq
MIRT1048384	hsa-miR-4766-5p	CLIP-seq
MIRT2243276	hsa-miR-101	CLIP-seq
MIRT2243277	hsa-miR-144	CLIP-seq
MIRT2243278	hsa-miR-582-5p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	2461352
GO:0006955	Process	Immune response	NAS	2461352
GO:0009986	Component	Cell surface	IMP	20356827
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IMP	20356827
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0032395	Function	MHC class II receptor activity	NAS	2461352
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032729	Process	Positive regulation of interferon-gamma production	IMP	20356827
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	20356827
GO:0042605	Function	Peptide antigen binding	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IDA	20356827
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050870	Process	Positive regulation of T cell activation	IMP	20356827
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0071346	Process	Cellular response to interferon-gamma	IDA	8568247
GO:0071556	Component	Integral component of lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
142880	4938	ENSG00000231389

Protein

UniProt ID

P20036

Protein name

HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)

Protein function

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T

PDB

3LQZ , 4P4K , 4P4R , 4P57 , 4P5K , 4P5M , 7T2A , 7T2B , 7T2C , 7T2D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00993	MHC_II_alpha	35 → 114	Class II histocompatibility antigen, alpha domain	Domain
PF07654	C1-set	120 → 201	Immunoglobulin C1-set domain	Domain

Sequence

MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL

Sequence length

260

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules MHC class II antigen presentation PD-1 signaling Interferon gamma signaling

Show/Hide Causal Diseases (11)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	30664745
Dermatitis	Dermatitis, Irritant	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	27258892
Diabetes insipidus	Diabetes Insipidus	rs781942628, rs104894747, rs104894748, rs104894749, rs104894750, rs28935496, rs2147483647, rs104894751, rs104894752, rs104894753, rs104894754, rs104894755, rs1569545523, rs104894756, rs104894757 View all (33 more)
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	17632545
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Hypertension	Hypertensive disease	rs13306026
Pulmonary arterial hypertension	Pulmonary arterial hypertension	rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424 View all (116 more)	30527956
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)
Renal insufficiency	Renal Insufficiency	rs1596536873
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	19503088, 21156761, 17804836
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771 View all (6 more)

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	21814517, 30929738	ClinVar
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		ClinVar
Otitis media	Chronic otitis media		ClinVar
Pancreatitis	Pancreatitis		ClinVar

HLA-DPA1 (major histocompatibility complex, class II, DP alpha 1)