HLA-DOB (major histocompatibility complex, class II, DO beta)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 3112
Gene name Major histocompatibility complex, class II, DO beta
Gene symbol HLA-DOB
Synonyms (NCBI Gene)
DOBHLA_DOB
Chromosome 6
Chromosome location 6p21.32
Summary HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading o
miRNA miRNA information provided by mirtarbase database.
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (22)
miRTarBase ID miRNA Experiments Reference
MIRT526746 hsa-miR-497-3p PAR-CLIP 22012620
MIRT526745 hsa-miR-7844-5p PAR-CLIP 22012620
MIRT526744 hsa-miR-513b-3p PAR-CLIP 22012620
MIRT526743 hsa-miR-4301 PAR-CLIP 22012620
MIRT526742 hsa-miR-616-3p PAR-CLIP 22012620
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (7)
Transcription factor Regulation Reference
CIITA Activation 11823510
CREB1 Unknown 12938212
POU2F2 Unknown 12938212
RFX1 Unknown 12938212
RFX5 Unknown 11258423
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (26)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002503 Process Peptide antigen assembly with MHC class II protein complex IBA
GO:0002504 Process Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II IEA
GO:0002587 Process Negative regulation of antigen processing and presentation of peptide antigen via MHC class II IDA 22733780
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
600629 4937 ENSG00000241106
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13765
Protein name HLA class II histocompatibility antigen, DO beta chain (MHC class II antigen DOB)
Protein function Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.
PDB 4I0P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00969 MHC_II_beta 39 → 113 Class II histocompatibility antigen, beta domain Domain
PF07654 C1-set 125 → 206 Immunoglobulin C1-set domain Domain
Sequence 
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Sequence length 273
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis 		  MHC class II antigen presentation