Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3112
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DO beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DOB
Synonyms (NCBI Gene) Gene synonyms aliases	DOB, HLA_DOB
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading o

Show/Hide all(22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT526746	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526745	hsa-miR-7844-5p	PAR-CLIP	22012620
MIRT526744	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT526743	hsa-miR-4301	PAR-CLIP	22012620
MIRT526742	hsa-miR-616-3p	PAR-CLIP	22012620
MIRT526741	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT526740	hsa-miR-1260a	PAR-CLIP	22012620
MIRT526739	hsa-miR-1260b	PAR-CLIP	22012620
MIRT526738	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT526746	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526745	hsa-miR-7844-5p	PAR-CLIP	22012620
MIRT526744	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT526743	hsa-miR-4301	PAR-CLIP	22012620
MIRT526742	hsa-miR-616-3p	PAR-CLIP	22012620
MIRT526741	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT526740	hsa-miR-1260a	PAR-CLIP	22012620
MIRT526739	hsa-miR-1260b	PAR-CLIP	22012620
MIRT526738	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT2243272	hsa-miR-4270	CLIP-seq
MIRT2243273	hsa-miR-4441	CLIP-seq
MIRT2243274	hsa-miR-4691-5p	CLIP-seq
MIRT2243275	hsa-miR-4772-5p	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
CIITA	Activation	11823510
CREB1	Unknown	12938212
POU2F2	Unknown	12938212
RFX1	Unknown	12938212
RFX5	Unknown	11258423
RFXANK	Unknown	11258423;12938212
RFXAP	Unknown	11258423

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0002587	Process	Negative regulation of antigen processing and presentation of peptide antigen via MHC class II	IDA	22733780
GO:0005764	Component	Lysosome	IDA	8890155
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0006955	Process	Immune response	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0023026	Function	MHC class II protein complex binding	IDA	22733780
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	TAS	2998758
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	22733780
GO:0042613	Component	MHC class II protein complex	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA

MIM	HGNC	e!Ensembl
600629	4937	ENSG00000241106

Protein

UniProt ID

P13765

Protein name

HLA class II histocompatibility antigen, DO beta chain (MHC class II antigen DOB)

Protein function

Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.

PDB

4I0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00969	MHC_II_beta	39 → 113	Class II histocompatibility antigen, beta domain	Domain
PF07654	C1-set	125 → 206	Immunoglobulin C1-set domain	Domain

Sequence

MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC

Sequence length

273

Interactions

View interactions

	KEGG		Reactome
	Phagosome Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Intestinal immune network for IgA production Type I diabetes mellitus Leishmaniasis Toxoplasmosis Staphylococcus aureus infection Tuberculosis Influenza A Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Epstein-Barr virus infection Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		MHC class II antigen presentation

HLA-DOB (major histocompatibility complex, class II, DO beta)