Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3110
Gene name	Motor neuron and pancreas homeobox 1
Gene symbol	MNX1
Synonyms (NCBI Gene)	HB9HLXB9HOXHB9SCRA1
Chromosome	7
Chromosome location	7q36.3
Summary	This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding dif

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027276	hsa-miR-101-3p	Sequencing	20371350
MIRT506572	hsa-miR-338-3p	PAR-CLIP	20371350
MIRT027276	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT506571	hsa-miR-548u	PAR-CLIP	20371350
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT506569	hsa-miR-4328	PAR-CLIP	20371350
MIRT506568	hsa-miR-4530	PAR-CLIP	20371350
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT506566	hsa-miR-5186	PAR-CLIP	20371350
MIRT506565	hsa-miR-2052	PAR-CLIP	20371350
MIRT506564	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	20371350
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	20371350
MIRT506561	hsa-miR-887-3p	PAR-CLIP	20371350
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	20371350
MIRT506559	hsa-miR-8055	PAR-CLIP	20371350
MIRT506572	hsa-miR-338-3p	PAR-CLIP	23446348
MIRT027276	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT506571	hsa-miR-548u	PAR-CLIP	23446348
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT506569	hsa-miR-4328	PAR-CLIP	23446348
MIRT506568	hsa-miR-4530	PAR-CLIP	23446348
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT506566	hsa-miR-5186	PAR-CLIP	23446348
MIRT506565	hsa-miR-2052	PAR-CLIP	23446348
MIRT506564	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT506559	hsa-miR-8055	PAR-CLIP	23446348
MIRT506572	hsa-miR-338-3p	PAR-CLIP	23446348
MIRT027276	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT506571	hsa-miR-548u	PAR-CLIP	23446348
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT506569	hsa-miR-4328	PAR-CLIP	23446348
MIRT506568	hsa-miR-4530	PAR-CLIP	23446348
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT506566	hsa-miR-5186	PAR-CLIP	23446348
MIRT506565	hsa-miR-2052	PAR-CLIP	23446348
MIRT506564	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT506561	hsa-miR-887-3p	PAR-CLIP	23446348
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT506559	hsa-miR-8055	PAR-CLIP	23446348
MIRT506572	hsa-miR-338-3p	PAR-CLIP	20371350
MIRT027276	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT506571	hsa-miR-548u	PAR-CLIP	20371350
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT506569	hsa-miR-4328	PAR-CLIP	20371350
MIRT506568	hsa-miR-4530	PAR-CLIP	20371350
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT506566	hsa-miR-5186	PAR-CLIP	20371350
MIRT506565	hsa-miR-2052	PAR-CLIP	20371350
MIRT506564	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	20371350
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	20371350
MIRT506561	hsa-miR-887-3p	PAR-CLIP	20371350
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	20371350
MIRT506559	hsa-miR-8055	PAR-CLIP	20371350
MIRT506572	hsa-miR-338-3p	PAR-CLIP	23446348
MIRT027276	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT506571	hsa-miR-548u	PAR-CLIP	23446348
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT506569	hsa-miR-4328	PAR-CLIP	23446348
MIRT506568	hsa-miR-4530	PAR-CLIP	23446348
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT506566	hsa-miR-5186	PAR-CLIP	23446348
MIRT506565	hsa-miR-2052	PAR-CLIP	23446348
MIRT506564	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT506559	hsa-miR-8055	PAR-CLIP	23446348
MIRT506572	hsa-miR-338-3p	PAR-CLIP	23446348
MIRT027276	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT506571	hsa-miR-548u	PAR-CLIP	23446348
MIRT506570	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT506569	hsa-miR-4328	PAR-CLIP	23446348
MIRT506568	hsa-miR-4530	PAR-CLIP	23446348
MIRT506567	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT506566	hsa-miR-5186	PAR-CLIP	23446348
MIRT506565	hsa-miR-2052	PAR-CLIP	23446348
MIRT506564	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT506563	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT506562	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT506561	hsa-miR-887-3p	PAR-CLIP	23446348
MIRT506560	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT506559	hsa-miR-8055	PAR-CLIP	23446348
MIRT1154074	hsa-miR-1184	CLIP-seq
MIRT1154075	hsa-miR-1205	CLIP-seq
MIRT1154076	hsa-miR-1297	CLIP-seq
MIRT1154077	hsa-miR-224	CLIP-seq
MIRT1154078	hsa-miR-26a	CLIP-seq
MIRT1154079	hsa-miR-26b	CLIP-seq
MIRT1154080	hsa-miR-298	CLIP-seq
MIRT1154081	hsa-miR-3158-5p	CLIP-seq
MIRT1154082	hsa-miR-3664-5p	CLIP-seq
MIRT1154083	hsa-miR-4465	CLIP-seq
MIRT1154084	hsa-miR-4467	CLIP-seq
MIRT1154085	hsa-miR-4714-5p	CLIP-seq
MIRT1154086	hsa-miR-498	CLIP-seq
MIRT1154087	hsa-miR-520a-5p	CLIP-seq
MIRT1154088	hsa-miR-525-5p	CLIP-seq
MIRT1154089	hsa-miR-181a	CLIP-seq
MIRT1154090	hsa-miR-181b	CLIP-seq
MIRT1154091	hsa-miR-181c	CLIP-seq
MIRT1154092	hsa-miR-181d	CLIP-seq
MIRT1154093	hsa-miR-3677-3p	CLIP-seq
MIRT1154094	hsa-miR-4262	CLIP-seq
MIRT1154095	hsa-miR-4434	CLIP-seq
MIRT1154096	hsa-miR-4516	CLIP-seq
MIRT1154097	hsa-miR-4649-5p	CLIP-seq
MIRT1154098	hsa-miR-548aa	CLIP-seq
MIRT1154076	hsa-miR-1297	CLIP-seq
MIRT1154078	hsa-miR-26a	CLIP-seq
MIRT1154079	hsa-miR-26b	CLIP-seq
MIRT1154083	hsa-miR-4465	CLIP-seq
MIRT2273454	hsa-miR-101	CLIP-seq
MIRT1154076	hsa-miR-1297	CLIP-seq
MIRT2273455	hsa-miR-141	CLIP-seq
MIRT2273456	hsa-miR-200a	CLIP-seq
MIRT1154077	hsa-miR-224	CLIP-seq
MIRT1154078	hsa-miR-26a	CLIP-seq
MIRT1154079	hsa-miR-26b	CLIP-seq
MIRT2273457	hsa-miR-370	CLIP-seq
MIRT2273458	hsa-miR-3917	CLIP-seq
MIRT2273459	hsa-miR-4318	CLIP-seq
MIRT1154083	hsa-miR-4465	CLIP-seq
MIRT1154084	hsa-miR-4467	CLIP-seq
MIRT2273460	hsa-miR-4690-3p	CLIP-seq
MIRT2273461	hsa-miR-4731-5p	CLIP-seq
MIRT2273462	hsa-miR-4783-5p	CLIP-seq
MIRT1154086	hsa-miR-498	CLIP-seq
MIRT1154087	hsa-miR-520a-5p	CLIP-seq
MIRT1154088	hsa-miR-525-5p	CLIP-seq
MIRT2273463	hsa-miR-629	CLIP-seq
MIRT2273464	hsa-miR-718	CLIP-seq
MIRT2273465	hsa-miR-887	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0021520	Process	Spinal cord motor neuron cell fate specification	IBA
GO:0021520	Process	Spinal cord motor neuron cell fate specification	IEA
GO:0031018	Process	Endocrine pancreas development	IBA
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
142994	4979	ENSG00000130675

P50219

Protein name

Motor neuron and pancreas homeobox protein 1 (Homeobox protein HB9)

Protein function

Transcription factor (By similarity). Recognizes and binds to the regulatory elements of target genes, such as visual system homeobox CHX10, negatively modulating transcription (By similarity). Plays a role in establishing motor neuron identity,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	242 → 298	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymphoid and pancreatic tissues.

Sequence

MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSP
ASSEPPAAPADRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPG
AAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHP
ALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGMILPKMPDFNSQAQSNLLGK
CRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK
KAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRDLRDSDPEEDE
DEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ

Sequence length

401

Interactions

View interactions

	KEGG
	Maturity onset diabetes of the young

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormality of the vertebral column	Likely pathogenic	rs2537771120	RCV005235716
Currarino triad	Likely pathogenic; Pathogenic	rs2134838779, rs2134846165, rs2134838783, rs2134846330, rs2537780168, rs121912546, rs2537781329, rs121912547, rs1563700090, rs1563700419, rs121912548, rs121912549, rs1554594329	RCV002245297 RCV002250119 RCV002273111 RCV002273137 RCV000015975 RCV000015976 RCV000015977 RCV000015978 RCV000015980 RCV000015981 RCV000015982 RCV000015984 RCV000504393
MNX1-related disorder	Likely pathogenic	rs2537780127, rs2537773911, rs2537771120	RCV003402535 RCV003397530 RCV003420920

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35237359
Breast Neoplasms	Inhibit	35697697
Breast Neoplasms	Associate	38203393
Carcinogenesis	Associate	15161049
Carcinoma Hepatocellular	Stimulate	21484430
Carcinoma Hepatocellular	Associate	36476366
Carcinoma Intraductal Noninfiltrating	Associate	35697697
Carcinoma Ovarian Epithelial	Associate	29271994, 29678219
Cell Transformation Neoplastic	Associate	36476366
Cerulean cataract	Associate	35583991
Constipation	Associate	24287836
Currarino triad	Associate	19838731, 22212327, 24287836, 25136833, 29401559, 32571425, 34509159
Developmental Disabilities	Associate	29061174
Diabetes Mellitus Transient Neonatal 1	Associate	34509159
Esophageal Squamous Cell Carcinoma	Associate	26857264, 31170665
Gastrointestinal Neoplasms	Associate	36429006
Glioblastoma	Associate	29678219, 30821221
Glioma	Associate	30066929
Hemochromatosis	Associate	31730496
Laryngeal Neoplasms	Associate	31416476
Leukemia Myeloid Acute	Associate	23048027, 35583991
Leukemia T Cell	Associate	25136833
Lung agenesis	Associate	34436670
Lymphatic Metastasis	Associate	30821221
Lymphatic Metastasis	Stimulate	31436258
Lymphoma Mantle Cell	Associate	22374828
Microcephaly	Associate	19838731
Neoplasm Metastasis	Associate	29271994, 31210302
Neoplasms	Stimulate	21484430
Neoplasms	Associate	25136833, 26857264, 30066929, 36429006, 36476366
Neuroblastoma	Associate	25136833
Osteosarcoma	Associate	31364121, 31646549
Ovarian Neoplasms	Associate	29271994, 34789303, 35639251
Prostatic Neoplasms	Associate	30980513
Sacral defect and anterior sacral meningocele	Associate	24287836, 25136833
Stomach Neoplasms	Associate	26857264, 30821221, 31210302, 35831348
Syndrome	Associate	22212327
Teratoma	Associate	22212327
Testicular Neoplasms	Associate	36429006
Uterine Cervical Neoplasms	Associate	30821221
Uterine Cervical Neoplasms	Stimulate	31436258

MNX1 (motor neuron and pancreas homeobox 1)