Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3108
Gene name Gene Name - the full gene name approved by the HGNC.	Major histocompatibility complex, class II, DM alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HLA-DMA
Synonyms (NCBI Gene) Gene synonyms aliases	D6S222E, DMA, HLADM, RING6
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018266	hsa-miR-335-5p	Microarray	18185580
MIRT2010988	hsa-miR-4642	CLIP-seq
MIRT2010989	hsa-miR-4720-5p	CLIP-seq
MIRT2010990	hsa-miR-4799-3p	CLIP-seq
MIRT2546421	hsa-miR-3151	CLIP-seq
MIRT2546422	hsa-miR-3202	CLIP-seq
MIRT2546423	hsa-miR-4265	CLIP-seq
MIRT2546424	hsa-miR-4271	CLIP-seq
MIRT2546425	hsa-miR-4296	CLIP-seq
MIRT2546426	hsa-miR-4312	CLIP-seq
MIRT2546427	hsa-miR-4322	CLIP-seq
MIRT2546428	hsa-miR-4447	CLIP-seq
MIRT2546429	hsa-miR-4472	CLIP-seq
MIRT2546430	hsa-miR-4725-3p	CLIP-seq
MIRT2546431	hsa-miR-4747-5p	CLIP-seq
MIRT2546432	hsa-miR-4764-5p	CLIP-seq
MIRT2546433	hsa-miR-491-5p	CLIP-seq
MIRT2546434	hsa-miR-625	CLIP-seq
MIRT2546421	hsa-miR-3151	CLIP-seq
MIRT2546422	hsa-miR-3202	CLIP-seq
MIRT2546423	hsa-miR-4265	CLIP-seq
MIRT2546424	hsa-miR-4271	CLIP-seq
MIRT2546425	hsa-miR-4296	CLIP-seq
MIRT2546426	hsa-miR-4312	CLIP-seq
MIRT2546427	hsa-miR-4322	CLIP-seq
MIRT2546428	hsa-miR-4447	CLIP-seq
MIRT2546429	hsa-miR-4472	CLIP-seq
MIRT2546430	hsa-miR-4725-3p	CLIP-seq
MIRT2546431	hsa-miR-4747-5p	CLIP-seq
MIRT2546432	hsa-miR-4764-5p	CLIP-seq
MIRT2546433	hsa-miR-491-5p	CLIP-seq
MIRT2546434	hsa-miR-625	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CIITA	Activation	9300700
CIITA	Unknown	7495736
RFX5	Unknown	11258423;7495736
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IDA	7606781, 9075930, 22733780, 23260142
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	21131964, 23222639
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	9075930
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0006955	Process	Immune response	IEA
GO:0009986	Component	Cell surface	IDA	22247549
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0023026	Function	MHC class II protein complex binding	IDA	9075930, 22733780, 23260142
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IDA	9075930
GO:0031902	Component	Late endosome membrane	IEA
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	7606781, 22247549, 22733780
GO:0042613	Component	MHC class II protein complex	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA

MIM	HGNC	e!Ensembl
142855	4934	ENSG00000204257

Protein

UniProt ID

P28067

Protein name

HLA class II histocompatibility antigen, DM alpha chain (MHC class II antigen DMA) (Really interesting new gene 6 protein)

Protein function

Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the inter

PDB

1HDM , 2BC4 , 4FQX , 4GBX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00993	MHC_II_alpha	41 → 118	Class II histocompatibility antigen, alpha domain	Domain
PF07654	C1-set	129 → 208	Immunoglobulin C1-set domain	Domain

Sequence

MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVD
GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD

Sequence length

261

Interactions

View interactions

HLA-DMA (major histocompatibility complex, class II, DM alpha)