STOML2 (stomatin like 2)

Gene

• Entrez ID: 30968
• Gene name: Stomatin like 2
• Gene symbol: STOML2
• Synonyms (NCBI Gene): HSPC108, SLP-2
• Chromosome: 9
• Chromosome location: 9p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029840	hsa-miR-26b-5p	Microarray	19088304
MIRT049902	hsa-miR-31-5p	CLASH	23622248
MIRT047030	hsa-miR-187-3p	CLASH	23622248
MIRT044836	hsa-miR-320a	CLASH	23622248
MIRT042553	hsa-miR-423-3p	CLASH	23622248
MIRT040042	hsa-miR-615-3p	CLASH	23622248
MIRT1399007	hsa-miR-3064-3p	CLIP-seq
MIRT1399008	hsa-miR-4252	CLIP-seq
MIRT1399009	hsa-miR-4299	CLIP-seq
MIRT1399010	hsa-miR-4710	CLIP-seq
MIRT1399011	hsa-miR-4715-3p	CLIP-seq
MIRT1399012	hsa-miR-4776-3p	CLIP-seq
MIRT1399013	hsa-miR-4792	CLIP-seq
MIRT1399014	hsa-miR-556-3p	CLIP-seq
MIRT1399007	hsa-miR-3064-3p	CLIP-seq
MIRT1399008	hsa-miR-4252	CLIP-seq
MIRT1399009	hsa-miR-4299	CLIP-seq
MIRT1399010	hsa-miR-4710	CLIP-seq
MIRT1399011	hsa-miR-4715-3p	CLIP-seq
MIRT1399012	hsa-miR-4776-3p	CLIP-seq
MIRT1399013	hsa-miR-4792	CLIP-seq
MIRT1399014	hsa-miR-556-3p	CLIP-seq
MIRT2341778	hsa-miR-561	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IDA	22623988
GO:0005515	Function	Protein binding	IPI	17121834, 21746876, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	17121834
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	IDA	17121834
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	22623988
GO:0005886	Component	Plasma membrane	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IMP	19944461
GO:0007005	Process	Mitochondrion organization	IBA
GO:0007005	Process	Mitochondrion organization	IMP	21746876
GO:0008289	Function	Lipid binding	IEA
GO:0010876	Process	Lipid localization	IEA
GO:0010876	Process	Lipid localization	ISS
GO:0015629	Component	Actin cytoskeleton	IDA	18641330
GO:0016020	Component	Membrane	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0034982	Process	Mitochondrial protein processing	IEA
GO:0034982	Process	Mitochondrial protein processing	ISS
GO:0035710	Process	CD4-positive, alpha-beta T cell activation	IEA
GO:0035710	Process	CD4-positive, alpha-beta T cell activation	ISS
GO:0042608	Function	T cell receptor binding	IDA	18641330
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	IEA
GO:0045121	Component	Membrane raft	IDA	18641330
GO:0045121	Component	Membrane raft	IEA
GO:0050852	Process	T cell receptor signaling pathway	IMP	18641330
GO:0051020	Function	GTPase binding	IPI	24337748
GO:0051259	Process	Protein complex oligomerization	IDA	17121834
GO:1901612	Function	Cardiolipin binding	IDA	21746876
GO:1990046	Process	Stress-induced mitochondrial fusion	IEA
GO:1990046	Process	Stress-induced mitochondrial fusion	ISS

Other IDs

• MIM: 608292
• HGNC: 14559
• e!Ensembl: ENSG00000165283

Protein

• UniProt ID: Q9UJZ1
• Protein name: Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7)
• Protein function: Mitochondrial protein that probably regulates the biogenesis and the activity of mitochondria. Stimulates cardiolipin biosynthesis, binds cardiolipin-enriched membranes where it recruits and stabilizes some proteins including prohibitin and may
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01145	Band_7	39 → 258	SPFH domain / Band 7 family	Family
  PF16200	Band_7_C	259 → 321	C-terminal region of band_7	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed at low levels. Expressed in lymphoid tissues (at protein level). {ECO:0000269|PubMed:10713127, ECO:0000269|PubMed:11435687, ECO:0000269|PubMed:18641330}.
• Sequence:

  MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
  PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
  DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
  HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
  AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
  NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS

• Sequence length: 356

Pathways

Reactome:

Processing of SMDT1

<