Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3091
Gene name Gene Name - the full gene name approved by the HGNC.	Hypoxia inducible factor 1 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HIF1A
Synonyms (NCBI Gene) Gene synonyms aliases	HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia

Show/Hide all(630)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000498	hsa-miR-20b-5p	qRT-PCR, ELISA, ChIP, Western blot	20232316
MIRT000496	hsa-miR-519c-3p	Luciferase reporter assay, qRT-PCR, Western blot	20233879
MIRT004487	hsa-miR-107	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20308559
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, Western blot, Northern blot	18632605
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, Western blot, Northern blot	18632605
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18632605
MIRT004588	hsa-miR-17-5p	Review	20144731
MIRT004587	hsa-miR-18a-5p	Review	20144731
MIRT004589	hsa-miR-19a-3p	Review	20144731
MIRT004590	hsa-miR-19b-3p	Review	20144731
MIRT000002	hsa-miR-20a-5p	Review	20144731
MIRT005926	hsa-miR-424-5p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20972335
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21847633
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	21875287
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	21875287
MIRT007022	hsa-miR-199b-5p	Luciferase reporter assay	21557766
MIRT006744	hsa-miR-138-5p	Luciferase reporter assay	23389731
MIRT028216	hsa-miR-33a-5p	Sequencing	20371350
MIRT004587	hsa-miR-18a-5p	Sequencing	20371350
MIRT051936	hsa-let-7b-5p	CLASH	23622248
MIRT038587	hsa-miR-106b-3p	CLASH	23622248
MIRT038587	hsa-miR-106b-3p	CLASH	23622248
MIRT054349	hsa-miR-210-3p	QRTPCR, Western blot	23618526
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24252850
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24839982
MIRT437403	hsa-miR-22-3p	Immunofluorescence, qRT-PCR, Western blot	24496460
MIRT006138	hsa-miR-199a-5p	Immunohistochemistry, qRT-PCR, Western blot	24022342
MIRT070742	hsa-miR-93-5p	Microarray, qRT-PCR	22815788
MIRT437916	hsa-miR-21-5p	ChIP-seq	23726431
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT004588	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT000002	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23911400
MIRT702964	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT702963	hsa-miR-3609	HITS-CLIP	23313552
MIRT702962	hsa-miR-548ah-5p	HITS-CLIP	23313552
MIRT702961	hsa-miR-625-3p	HITS-CLIP	23313552
MIRT702960	hsa-miR-3128	HITS-CLIP	23313552
MIRT702959	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT702958	hsa-miR-558	HITS-CLIP	23313552
MIRT702957	hsa-miR-4487	HITS-CLIP	23313552
MIRT702956	hsa-miR-4470	HITS-CLIP	23313552
MIRT279539	hsa-miR-5681b	HITS-CLIP	23313552
MIRT138601	hsa-miR-8055	HITS-CLIP	23313552
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT557319	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT557318	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT070734	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT070739	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT557317	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT557316	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT557315	hsa-miR-940	PAR-CLIP	21572407
MIRT557314	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT557313	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT557312	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT070740	hsa-miR-6755-5p	PAR-CLIP	21572407
MIRT557311	hsa-miR-4464	PAR-CLIP	21572407
MIRT557310	hsa-miR-4748	PAR-CLIP	21572407
MIRT557309	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT070735	hsa-miR-3074-3p	PAR-CLIP	21572407
MIRT070737	hsa-miR-5094	PAR-CLIP	21572407
MIRT070730	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT070733	hsa-miR-935	PAR-CLIP	21572407
MIRT070741	hsa-miR-6806-5p	PAR-CLIP	21572407
MIRT070731	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT191501	hsa-miR-3662	PAR-CLIP	22012620
MIRT398180	hsa-miR-5692a	PAR-CLIP	22012620
MIRT536882	hsa-miR-1322	PAR-CLIP	22012620
MIRT191495	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	22012620
MIRT070745	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000002	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT070745	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT004588	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT000498	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT070742	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT070750	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT000002	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT398178	hsa-miR-155-5p	qRT-PCR, Immunohistochemistry, Western blot	25143000
MIRT735728	hsa-miR-429	qRT-PCR, Western blot	25550463
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	26344589
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731348	hsa-miR-142-5p	Luciferase reporter assay, Western blot	28069592
MIRT731838	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26292288
MIRT731838	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26292288
MIRT731849	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	27815672
MIRT731849	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	27815672
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay	27080303
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26622381
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26622381
MIRT070743	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT070745	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT191495	hsa-miR-153-5p	Luciferase reporter assay, Western blot	27554040
MIRT000498	hsa-miR-20b-5p	qRT-PCR	26793992
MIRT000498	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26612965
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26783726
MIRT191496	hsa-miR-18b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220837
MIRT191496	hsa-miR-18b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220837
MIRT070742	hsa-miR-93-5p	Flow, Immunocytochemistry, Next Generation Sequencing (NGS), qRT-PCR	26815014
MIRT028216	hsa-miR-33a-5p	Luciferase reporter assay	25891797
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	27122154
MIRT006138	hsa-miR-199a-5p	Luciferase reporter assay	27122154
MIRT732716	hsa-miR-135b-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR	32085620
MIRT732760	hsa-miR-31-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR	32085620
MIRT006744	hsa-miR-138-5p	Immunofluorescence, qRT-PCR	33919449
MIRT054349	hsa-miR-210-3p	Immunofluorescence, qRT-PCR	33919449
MIRT733182	hsa-miR-4646-5p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33875796
MIRT733668	hsa-miR-373-3p	ELISA, qRT-PCR	33997006
MIRT191501	hsa-miR-3662	Immunohistochemistry (IHC), qRT-PCR, Western blotting	33864618
MIRT000496	hsa-miR-519c-3p	qRT-PCR, Western blotting	33177098
MIRT398178	hsa-miR-155-5p	qRT-PCR	33062603
MIRT734281	hsa-miR-646	Luciferase reporter assay, qRT-PCR, Western blotting	32782496
MIRT054349	hsa-miR-210-3p	Immunoprecipitaion (IP), In situ hybridization, Luciferase reporter assay, Western blotting	31616934
MIRT734775	hsa-miR-130a-3p	Western blotting, RNA-seq, qRT-PCR, Flow cytometry, Immunocytochemistry (ICC)	33614244
MIRT734877	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT735674	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	32873879
MIRT735728	hsa-miR-429	Luciferase reporter assay, Western blotting, qRT-PCR	31903105
MIRT736183	hsa-miR-17-3p	Western blotting, Microarray, qRT-PCR	31916114
MIRT736184	hsa-miR-92a-3p	Western blotting, Microarray, qRT-PCR	31916114
MIRT004587	hsa-miR-18a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32210827
MIRT736307	hsa-miR-34a-3p	Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32102296
MIRT736597	hsa-miR-200c-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32960511
MIRT191501	hsa-miR-3662	Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33993382
MIRT736947	hsa-miR-375	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32215815
MIRT737114	hsa-miR-346	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32403237
MIRT737147	hsa-miR-7641	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	34238918
MIRT737344	hsa-miR-18a-3p	Western blotting, Microarray, qRT-PCR	32226492
MIRT737533	hsa-miR-31-3p	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT004487	hsa-miR-107	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT732716	hsa-miR-135b-5p	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization	32085620
MIRT737571	hsa-miR-30a-5p	Western blotting, qRT-PCR	31772711
MIRT702964	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT702963	hsa-miR-3609	HITS-CLIP	23313552
MIRT702962	hsa-miR-548ah-5p	HITS-CLIP	23313552
MIRT702961	hsa-miR-625-3p	HITS-CLIP	23313552
MIRT702960	hsa-miR-3128	HITS-CLIP	23313552
MIRT702959	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT702958	hsa-miR-558	HITS-CLIP	23313552
MIRT702957	hsa-miR-4487	HITS-CLIP	23313552
MIRT702956	hsa-miR-4470	HITS-CLIP	23313552
MIRT279539	hsa-miR-5681b	HITS-CLIP	23313552
MIRT138601	hsa-miR-8055	HITS-CLIP	23313552
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT557319	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT557318	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT070734	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT070739	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT557317	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT557316	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT557315	hsa-miR-940	PAR-CLIP	21572407
MIRT557314	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT557313	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT557312	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT070740	hsa-miR-6755-5p	PAR-CLIP	21572407
MIRT557311	hsa-miR-4464	PAR-CLIP	21572407
MIRT557310	hsa-miR-4748	PAR-CLIP	21572407
MIRT557309	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT070735	hsa-miR-3074-3p	PAR-CLIP	21572407
MIRT070737	hsa-miR-5094	PAR-CLIP	21572407
MIRT070730	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT070733	hsa-miR-935	PAR-CLIP	21572407
MIRT070741	hsa-miR-6806-5p	PAR-CLIP	21572407
MIRT070731	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT279526	hsa-miR-151a-3p	PAR-CLIP	21572407
MIRT070774	hsa-miR-4282	PAR-CLIP	21572407
MIRT070721	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT547981	hsa-miR-4499	PAR-CLIP	21572407
MIRT547980	hsa-miR-4463	PAR-CLIP	21572407
MIRT191510	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT070723	hsa-miR-3668	PAR-CLIP	21572407
MIRT070728	hsa-miR-6815-3p	PAR-CLIP	21572407
MIRT547979	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT547978	hsa-miR-217	PAR-CLIP	21572407
MIRT547977	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT191501	hsa-miR-3662	PAR-CLIP	21572407
MIRT398180	hsa-miR-5692a	PAR-CLIP	21572407
MIRT547976	hsa-miR-4418	PAR-CLIP	21572407
MIRT547975	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT547974	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT536882	hsa-miR-1322	PAR-CLIP	21572407
MIRT191495	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	21572407
MIRT004587	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT191496	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT191502	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT191501	hsa-miR-3662	PAR-CLIP	22012620
MIRT398180	hsa-miR-5692a	PAR-CLIP	22012620
MIRT536882	hsa-miR-1322	PAR-CLIP	22012620
MIRT191495	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT536881	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT536880	hsa-miR-5089-3p	PAR-CLIP	22012620
MIRT070750	hsa-miR-519d-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, Flow cytometry	35959792
MIRT070742	hsa-miR-93-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37029581
MIRT755679	hsa-miR-4693-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38668380
MIRT054349	hsa-miR-210-3p	Microarray, qRT-PCR	35816043
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT1045595	hsa-miR-138	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT1045598	hsa-miR-194	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT1045606	hsa-miR-3145-3p	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT1045609	hsa-miR-3171	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045611	hsa-miR-340	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045614	hsa-miR-3658	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT1045621	hsa-miR-4318	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1045625	hsa-miR-4504	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT755679	hsa-miR-4693-5p	CLIP-seq
MIRT1045635	hsa-miR-4699-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT1045638	hsa-miR-4774-5p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045641	hsa-miR-495	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT1045647	hsa-miR-542-3p	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT1045649	hsa-miR-548p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045659	hsa-miR-892a	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045649	hsa-miR-548p	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045606	hsa-miR-3145-3p	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT1045621	hsa-miR-4318	CLIP-seq
MIRT1045625	hsa-miR-4504	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT755679	hsa-miR-4693-5p	CLIP-seq
MIRT1045635	hsa-miR-4699-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045647	hsa-miR-542-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045659	hsa-miR-892a	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045607	hsa-miR-3152-3p	CLIP-seq
MIRT1045612	hsa-miR-3591-5p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045619	hsa-miR-4255	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT1045658	hsa-miR-889	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT1045613	hsa-miR-3653	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT2545962	hsa-miR-1248	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT2545963	hsa-miR-3064-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2545964	hsa-miR-3143	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT2545965	hsa-miR-376a	CLIP-seq
MIRT2545966	hsa-miR-376b	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT2545967	hsa-miR-4297	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT2545968	hsa-miR-448	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT2545969	hsa-miR-4639-5p	CLIP-seq
MIRT2545970	hsa-miR-4642	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2545971	hsa-miR-4717-5p	CLIP-seq
MIRT2545972	hsa-miR-4724-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT2545973	hsa-miR-4777-5p	CLIP-seq
MIRT2545974	hsa-miR-4778-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT2545975	hsa-miR-4803	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT2545976	hsa-miR-518d-5p	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT2545977	hsa-miR-519b-5p	CLIP-seq
MIRT2545978	hsa-miR-519c-5p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT2545979	hsa-miR-520c-5p	CLIP-seq
MIRT2545980	hsa-miR-520d-5p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2545981	hsa-miR-524-5p	CLIP-seq
MIRT2545982	hsa-miR-526a	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT2545983	hsa-miR-548c-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT2545984	hsa-miR-578	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2545985	hsa-miR-586	CLIP-seq
MIRT2545986	hsa-miR-590-3p	CLIP-seq
MIRT2545987	hsa-miR-600	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq
MIRT1045589	hsa-miR-106a	CLIP-seq
MIRT1045590	hsa-miR-106b	CLIP-seq
MIRT1045591	hsa-miR-1245b-3p	CLIP-seq
MIRT2545962	hsa-miR-1248	CLIP-seq
MIRT1045592	hsa-miR-1265	CLIP-seq
MIRT1045593	hsa-miR-1273c	CLIP-seq
MIRT1045594	hsa-miR-1276	CLIP-seq
MIRT2682296	hsa-miR-1305	CLIP-seq
MIRT2429567	hsa-miR-155	CLIP-seq
MIRT1045596	hsa-miR-17	CLIP-seq
MIRT1045597	hsa-miR-186	CLIP-seq
MIRT2429568	hsa-miR-203	CLIP-seq
MIRT1045599	hsa-miR-2053	CLIP-seq
MIRT1045600	hsa-miR-20a	CLIP-seq
MIRT1045601	hsa-miR-20b	CLIP-seq
MIRT1045602	hsa-miR-219-2-3p	CLIP-seq
MIRT1549495	hsa-miR-2682	CLIP-seq
MIRT1045603	hsa-miR-2964a-3p	CLIP-seq
MIRT2545963	hsa-miR-3064-3p	CLIP-seq
MIRT1045604	hsa-miR-3120-5p	CLIP-seq
MIRT1045605	hsa-miR-3133	CLIP-seq
MIRT2545964	hsa-miR-3143	CLIP-seq
MIRT2242402	hsa-miR-3144-3p	CLIP-seq
MIRT1045608	hsa-miR-3163	CLIP-seq
MIRT2429569	hsa-miR-330-3p	CLIP-seq
MIRT1045610	hsa-miR-338-5p	CLIP-seq
MIRT1045615	hsa-miR-3692	CLIP-seq
MIRT2242403	hsa-miR-371b-5p	CLIP-seq
MIRT1045616	hsa-miR-376c	CLIP-seq
MIRT2682297	hsa-miR-380	CLIP-seq
MIRT1045617	hsa-miR-3921	CLIP-seq
MIRT2682298	hsa-miR-3924	CLIP-seq
MIRT1045618	hsa-miR-3941	CLIP-seq
MIRT2429570	hsa-miR-4275	CLIP-seq
MIRT2545967	hsa-miR-4297	CLIP-seq
MIRT1045620	hsa-miR-4310	CLIP-seq
MIRT2429571	hsa-miR-4422	CLIP-seq
MIRT1045622	hsa-miR-4427	CLIP-seq
MIRT1045623	hsa-miR-4461	CLIP-seq
MIRT2545968	hsa-miR-448	CLIP-seq
MIRT1045624	hsa-miR-4495	CLIP-seq
MIRT1549496	hsa-miR-449c	CLIP-seq
MIRT1045626	hsa-miR-4530	CLIP-seq
MIRT2545969	hsa-miR-4639-5p	CLIP-seq
MIRT2545970	hsa-miR-4642	CLIP-seq
MIRT1045627	hsa-miR-4653-5p	CLIP-seq
MIRT1045628	hsa-miR-466	CLIP-seq
MIRT1045629	hsa-miR-4668-3p	CLIP-seq
MIRT1045630	hsa-miR-4670-5p	CLIP-seq
MIRT1045631	hsa-miR-4672	CLIP-seq
MIRT1045632	hsa-miR-4677-3p	CLIP-seq
MIRT1045633	hsa-miR-4679	CLIP-seq
MIRT1045634	hsa-miR-4680-3p	CLIP-seq
MIRT2242404	hsa-miR-4698	CLIP-seq
MIRT2545972	hsa-miR-4724-3p	CLIP-seq
MIRT1045636	hsa-miR-4731-3p	CLIP-seq
MIRT1045637	hsa-miR-4768-5p	CLIP-seq
MIRT2545973	hsa-miR-4777-5p	CLIP-seq
MIRT2545974	hsa-miR-4778-3p	CLIP-seq
MIRT2429572	hsa-miR-4795-3p	CLIP-seq
MIRT1045639	hsa-miR-4801	CLIP-seq
MIRT2545975	hsa-miR-4803	CLIP-seq
MIRT1045640	hsa-miR-494	CLIP-seq
MIRT2545976	hsa-miR-518d-5p	CLIP-seq
MIRT1045642	hsa-miR-519a	CLIP-seq
MIRT1045643	hsa-miR-519b-3p	CLIP-seq
MIRT2545977	hsa-miR-519b-5p	CLIP-seq
MIRT2545978	hsa-miR-519c-5p	CLIP-seq
MIRT1045644	hsa-miR-519d	CLIP-seq
MIRT2545979	hsa-miR-520c-5p	CLIP-seq
MIRT2545980	hsa-miR-520d-5p	CLIP-seq
MIRT1045645	hsa-miR-520g	CLIP-seq
MIRT1045646	hsa-miR-520h	CLIP-seq
MIRT2545981	hsa-miR-524-5p	CLIP-seq
MIRT2545982	hsa-miR-526a	CLIP-seq
MIRT2429573	hsa-miR-539	CLIP-seq
MIRT1045648	hsa-miR-548ah	CLIP-seq
MIRT2545983	hsa-miR-548c-3p	CLIP-seq
MIRT1045650	hsa-miR-549	CLIP-seq
MIRT2429574	hsa-miR-556-5p	CLIP-seq
MIRT1045651	hsa-miR-562	CLIP-seq
MIRT1045652	hsa-miR-569	CLIP-seq
MIRT2545984	hsa-miR-578	CLIP-seq
MIRT1045653	hsa-miR-580	CLIP-seq
MIRT1045654	hsa-miR-582-5p	CLIP-seq
MIRT2545985	hsa-miR-586	CLIP-seq
MIRT2545986	hsa-miR-590-3p	CLIP-seq
MIRT2545987	hsa-miR-600	CLIP-seq
MIRT2242405	hsa-miR-622	CLIP-seq
MIRT1045655	hsa-miR-626	CLIP-seq
MIRT1045656	hsa-miR-633	CLIP-seq
MIRT1045657	hsa-miR-640	CLIP-seq
MIRT2242406	hsa-miR-767-3p	CLIP-seq
MIRT2429575	hsa-miR-888	CLIP-seq
MIRT1045660	hsa-miR-93	CLIP-seq
MIRT2429576	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(26)

Transcription factor	Regulation	Reference
ARNT	Activation	14764593
BRCA1	Unknown	16543242
EGR1	Activation	18506761
FOXO4	Repression	12761217;20136501
HDAC7	Activation	20693714
HDAC7	Repression	22172637
HIF1A	Repression	14744852
HIF3A	Unknown	19755485
HIPK2	Repression	19046997
HSF2	Unknown	21258402
HSF4	Unknown	21258402
KLF5	Activation	23880760
LIMD1	Repression	22286099
MITF	Activation	22012259
NFKB1	Unknown	18498249
NFKB2	Repression	19414801
RELA	Unknown	18498249
SIRT1	Activation	22245592
STAT3	Activation	17597020;18644974;19265129
STAT3	Unknown	23991099
USF2	Unknown	23991099
VHL	Repression	11987242
VHL	Unknown	11727931;19238077
YY1	Unknown	20660740
ZFP36	Activation	19962963
ZFP36	Repression	19962963

Show/Hide all(134)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IDA	32697943
GO:0000785	Component	Chromatin	IDA	19782034
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19782034
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	8387214, 9079689
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	7539918, 8756616
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19782034
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	24983504
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IDA	8756616, 9887100, 11782478, 15261140, 18419598
GO:0001666	Process	Response to hypoxia	IMP	12411310
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS	18037992
GO:0001892	Process	Embryonic placenta development	IEA
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IC	8756616
GO:0001947	Process	Heart looping	IEA
GO:0002039	Function	P53 binding	IPI	15629713
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	ISS	18037992
GO:0002534	Process	Cytokine production involved in inflammatory response	IDA	32697943
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003208	Process	Cardiac ventricle morphogenesis	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11782478, 18658046, 25043030
GO:0003700	Function	DNA-binding transcription factor activity	TAS	15261140
GO:0005515	Function	Protein binding	IPI	9704006, 9887100, 11292862, 12004076, 12050673, 12446723, 14668441, 15261140, 15721254, 16424018, 16511565, 16543236, 17003112, 17024177, 17353276, 17382325, 17426252, 18268343, 18323857, 18427106, 18509053, 18775313, 19071119, 19168635, 19680224, 20562859, 20603618, 20661221, 20840
GO:0005634	Component	Nucleus	IDA	8089148, 15261140, 18658046, 20810912, 20972335, 22848707, 24048733, 25043030
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IPI	9576906
GO:0005737	Component	Cytoplasm	IDA	19651758, 24048733
GO:0005829	Component	Cytosol	IDA	24681946
GO:0005829	Component	Cytosol	TAS
GO:0006089	Process	Lactate metabolic process	IEA
GO:0006110	Process	Regulation of glycolytic process	IDA	32697943
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	11782478, 15261140
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006879	Process	Cellular iron ion homeostasis	IEA
GO:0007165	Process	Signal transduction	IMP	12411310
GO:0007595	Process	Lactation	IEA
GO:0008134	Function	Transcription factor binding	IPI	7539918
GO:0008542	Process	Visual learning	IEA
GO:0010039	Process	Response to iron ion	IEP	28296633
GO:0010468	Process	Regulation of gene expression	IDA	18419598, 32697943
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12958148
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	8756616
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	18658046
GO:0010628	Process	Positive regulation of gene expression	IDA	15459207, 24244340
GO:0010628	Process	Positive regulation of gene expression	IMP	21817107, 22886504
GO:0010629	Process	Negative regulation of gene expression	IMP	26879375
GO:0010634	Process	Positive regulation of epithelial cell migration	ISS	18037992
GO:0014850	Process	Response to muscle activity	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0016607	Component	Nuclear speck	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019896	Process	Axonal transport of mitochondrion	IMP	19528298
GO:0019899	Function	Enzyme binding	IPI	11641274
GO:0019901	Function	Protein kinase binding	IPI	20889502
GO:0019904	Function	Protein domain specific binding	IPI	14594809
GO:0021502	Process	Neural fold elevation formation	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030502	Process	Negative regulation of bone mineralization	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	8756616, 12958148
GO:0031514	Component	Motile cilium	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11641274
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032364	Process	Oxygen homeostasis	IDA	16956324
GO:0032722	Process	Positive regulation of chemokine production	TAS	18370914
GO:0032909	Process	Regulation of transforming growth factor beta2 production	IMP	12411310
GO:0032963	Process	Collagen metabolic process	ISS	18037992
GO:0032991	Component	Protein-containing complex	IMP	14594809, 15629713
GO:0035035	Function	Histone acetyltransferase binding	IPI	15261140
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035257	Function	Nuclear hormone receptor binding	IPI	18658046
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042541	Process	Hemoglobin biosynthetic process	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	26879375
GO:0043565	Function	Sequence-specific DNA binding	IDA	7539918, 8756616, 9079689
GO:0043619	Process	Regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IDA	8089148, 8387214
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IC	1448077
GO:0045766	Process	Positive regulation of angiogenesis	IC	8756616
GO:0045766	Process	Positive regulation of angiogenesis	IMP	24048733, 26879375
GO:0045821	Process	Positive regulation of glycolytic process	IC	8089148
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	9887100, 25043030
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	21056661
GO:0045926	Process	Negative regulation of growth	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7539918, 8089148, 11573933, 32697943
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	9576906, 17981124
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	24048733
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046886	Process	Positive regulation of hormone biosynthetic process	IDA	1448077
GO:0046982	Function	Protein heterodimerization activity	IPI	9079689, 12239177
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	TAS	18254728
GO:0051216	Process	Cartilage development	IEA
GO:0051541	Process	Elastin metabolic process	ISS	18037992
GO:0051879	Function	Hsp90 protein binding	IDA	9079689
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	IEA
GO:0061072	Process	Iris morphogenesis	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061419	Process	Positive regulation of transcription from RNA polymerase II promoter in response to hypoxia	IDA	22735262
GO:0061419	Process	Positive regulation of transcription from RNA polymerase II promoter in response to hypoxia	IMP	19652095, 24681946
GO:0070101	Process	Positive regulation of chemokine-mediated signaling pathway	IDA	17178876
GO:0070244	Process	Negative regulation of thymocyte apoptotic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEP	12958148
GO:0071456	Process	Cellular response to hypoxia	IBA	21873635
GO:0071456	Process	Cellular response to hypoxia	IDA	11573933, 19528298, 20889502
GO:0071456	Process	Cellular response to hypoxia	IEP	19782034, 20810912
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	7539918, 8756616
GO:0097411	Process	Hypoxia-inducible factor-1alpha signaling pathway	IEA
GO:0098586	Process	Cellular response to virus	IDA	32697943
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	19782034
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IMP	19141645, 24983504
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	24899725
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IEA
GO:1903715	Process	Regulation of aerobic respiration	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:2000273	Process	Positive regulation of signaling receptor activity	IMP	17178876
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA
GO:2000434	Process	Regulation of protein neddylation	IMP	23401859
GO:2001054	Process	Negative regulation of mesenchymal cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
603348	4910	ENSG00000100644

Protein

UniProt ID

Q16665

Protein name

Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8)

Protein function

Functions as a master transcriptional regulator of the adaptive response to hypoxia (PubMed:11292861, PubMed:11566883, PubMed:15465032, PubMed:16973622, PubMed:17610843, PubMed:18658046, PubMed:20624928, PubMed:22009797, PubMed:30125331, PubMed:

PDB

1H2K , 1H2L , 1H2M , 1L3E , 1L8C , 1LM8 , 1LQB , 2ILM , 3HQR , 3HQU , 4AJY , 4H6J , 5JWP , 5L9B , 5L9V , 5LA9 , 5LAS , 6GFX , 6GMR , 6YW3 , 7LVS , 7QGS , 8HE0 , 8HE3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00989	PAS	90 → 188	PAS fold	Domain
PF08447	PAS_3	252 → 339	PAS fold	Domain
PF11413	HIF-1	551 → 581	Hypoxia-inducible factor-1	Family
PF08778	HIF-1a_CTAD	789 → 825	HIF-1 alpha C terminal transactivation domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding o

Sequence

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Sequence length

826

Interactions

View interactions

	KEGG		Reactome
	HIF-1 signaling pathway Mitophagy - animal Autophagy - animal Efferocytosis Th17 cell differentiation Thyroid hormone signaling pathway Kaposi sarcoma-associated herpesvirus infection Pathways in cancer Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species Renal cell carcinoma Central carbon metabolism in cancer Choline metabolism in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer		Regulation of gene expression by Hypoxia-inducible Factor Cellular response to hypoxia Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Ub-specific processing proteases Interleukin-4 and Interleukin-13 signaling PTK6 Expression PTK6 promotes HIF1A stabilization Neddylation

Show/Hide Causal Diseases (14)

Disease term	Disease name	dbSNP ID	References
Causal
Astrocytoma	Astrocytoma, Subependymal Giant Cell Astrocytoma, Juvenile Pilocytic Astrocytoma, Diffuse Astrocytoma, Pilocytic Astrocytoma, Childhood Cerebral Astrocytoma, Cerebral Astrocytoma	rs555607708	15341671
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	24349381
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	24349381
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	19808899
Congenital heart defects	Congenital Heart Defects	rs267607101, rs121434422, rs387906498, rs397509416, rs587777371, rs587777372, rs587777374, rs367537998, rs797044882, rs886041730, rs768027510, rs1064793873, rs1555447012, rs1554263268, rs1554263321 View all (13 more)	26073000
Erythrocytosis	Erythrocytosis familial, 1	rs119476044, rs119476045, rs137853036, rs137853037, rs35020585, rs33949869, rs33987903, rs36020563, rs35890959, rs1141387, rs35117167, rs33969677, rs33918338, rs33951978, rs33954595 View all (9 more)	22274579
Esophagus neoplasm	Squamous cell carcinoma of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	17201171
Glioblastoma	Glioblastoma, Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888	12811834
Hypertension	Hypertensive disease	rs13306026	22349312
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	30381462
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	24349381
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	16628086
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	16205110
Pulmonary fibrosis	Idiopathic Pulmonary Fibrosis, Familial Idiopathic Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)	28434932

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Congestive heart failure	Congestive heart failure	15732037	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	15732037	ClinVar
Mental depression	Mental Depression, Unipolar Depression, Major Depressive Disorder	23333658	ClinVar
Myocardial infarction	Myocardial Failure	15732037	ClinVar

Show/Hide Text Mining Associations (635)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	36480544
Abortion Habitual	Associate	27018158
Abortion Spontaneous	Inhibit	22135724
Acidosis	Associate	36012235
Acidosis Lactic	Inhibit	22135092
Acidosis Renal Tubular	Associate	39349238
Acquired Immunodeficiency Syndrome	Associate	19204000
Acute Aortic Syndrome	Associate	33953793
Acute Kidney Injury	Associate	12885785, 19279559, 33491566, 35587223, 36655871
Acute Lung Injury	Associate	36142499, 37989425
Acute On Chronic Liver Failure	Associate	29369172
Adenocarcinoma	Associate	17179985, 19211554, 19436307, 23295589, 24943686, 31077234
Adenocarcinoma Follicular	Stimulate	28474313
Adenocarcinoma of Lung	Associate	19887373, 25242053, 28202516, 30665327, 31375661, 31432173, 32439898, 33850110, 35996717, 38224012
Adenoma	Associate	18983642, 22551172
Aging Premature	Associate	31089163
Airway Remodeling	Associate	21557221
Allergic Fungal Sinusitis	Associate	32673430
Alopecia	Associate	35862273
Alopecia	Inhibit	36707659
Alopecia Areata	Associate	37446376
Altitude Sickness	Associate	26368009
Altitude Sickness	Inhibit	32033172
Alveolar capillary dysplasia	Stimulate	35649494
Alzheimer Disease	Associate	26228060, 31291905, 32341353, 32980851, 36035305, 39518952
Ameloblastoma	Associate	33067558
Anemia	Associate	16826581, 34617686
Anemia Hemolytic	Associate	24120591
Anemia Sickle Cell	Associate	21175428, 32352161
Aneuploidy	Associate	30332653
Aneurysm	Associate	35069552
Angina Stable	Associate	24089028, 36435742
Angina Unstable	Associate	24089028
Anhedonia	Associate	32198016
Ankyloglossia	Stimulate	37329213
Anodontia	Associate	34421088
Aortic Aneurysm Abdominal	Associate	24657063, 29191809, 35055064
Aortic Aneurysm Thoracic	Stimulate	25550800
Aortic Aneurysm Thoracic	Associate	37801489
Aortic Dissection	Associate	25550800, 26339353, 28415624
Arrhythmias Cardiac	Associate	31375661
Arteriovenous Fistula	Associate	35320939
Arthritis Juvenile	Associate	18512817
Arthritis Rheumatoid	Associate	12384916, 12823854, 20353560, 22488178, 26604208, 28067317, 33362761, 34385542, 34877935, 35690741, 35720293, 38166916, 40190499
Arthritis Rheumatoid	Stimulate	23967327, 34588517
Ascites	Associate	29085834
Asphyxia	Inhibit	34067945
Asthenozoospermia	Associate	30222022
Asthma	Associate	31430856
Astrocytoma	Associate	16724682, 25790191
Atherosclerosis	Associate	12586627, 20719466, 33299319, 35069552
Atrial Fibrillation	Stimulate	20631454
Atrial Fibrillation	Associate	36226239
Atrophy	Associate	25700369
Atypical Squamous Cells of the Cervix	Associate	26985936
Autoimmune Diseases	Associate	37558878
Beta ketothiolase deficiency	Associate	15084243, 24567056
Biliary Atresia	Associate	36150932
Biliary Tract Neoplasms	Associate	25446376
Birt Hogg Dube Syndrome	Associate	21057536
Blood Coagulation Disorders	Associate	26598923, 37801489
Blood Loss Surgical	Associate	24120591
Bone Diseases	Associate	26460121, 36134117, 36147560, 36967561
Bone Marrow Diseases	Associate	33921064
Bone Resorption	Associate	28097375
Brain Diseases	Associate	12764056
Brain Edema	Associate	23877362, 32908869
Brain Injuries Diffuse	Associate	37239335
Brain Ischemia	Associate	15770733, 17511040, 23770788, 27951596, 36150932
Breast Neoplasms	Associate	12627523, 15084243, 15217513, 15677538, 15967109, 16168127, 16543242, 16847054, 16899602, 17140257, 17224643, 17332506, 17426247, 17597020, 18096060 View all (126 more)
Breast Neoplasms Male	Associate	22684218
Burkitt Lymphoma	Associate	26312753
Burkitt Lymphoma	Stimulate	31560931
Calcinosis	Associate	28474313, 31034990
Calcinosis Cutis	Associate	18528739, 21945343, 25965573, 27244898, 32686360, 33751828
Calcinosis Cutis	Inhibit	21945343
Cancer Pain	Associate	33000216, 35265311
Carcinogenesis	Associate	12070140, 12213806, 12387890, 15082527, 16080559, 16884534, 17179985, 17452774, 18493321, 18983642, 19359588, 20596845, 20829524, 21156006, 21778301 View all (22 more)
Carcinogenesis	Stimulate	22355351, 23977378
Carcinoid Tumor	Associate	21557221
Carcinoma	Stimulate	29085834
Carcinoma Adenoid Cystic	Associate	25485635, 26323347, 32386517
Carcinoma Adenoid Cystic	Stimulate	25997612
Carcinoma Basal Cell	Stimulate	21672245
Carcinoma Basal Cell	Associate	25181405
Carcinoma Ductal Breast	Associate	16080559, 21824412, 23409121
Carcinoma Embryonal	Inhibit	27303043
Carcinoma Endometrioid	Associate	17452774, 20565904
Carcinoma Hepatocellular	Associate	15786555, 18651980, 19286567, 19948069, 20924210, 21332301, 21840307, 22178269, 23496980, 23792163, 23852087, 23958427, 23966163, 24346287, 24590895 View all (67 more)
Carcinoma Intraductal Noninfiltrating	Associate	23409121, 32980776
Carcinoma Non Small Cell Lung	Associate	11556841, 15736311, 15802268, 17699846, 19190516, 19245702, 19265129, 20736951, 21724587, 22349311, 23059773, 23295589, 23869238, 23886154, 24335195 View all (35 more)
Carcinoma Non Small Cell Lung	Stimulate	26339353
Carcinoma Ovarian Epithelial	Associate	20831794, 21620448, 23202951, 23545606, 27044634, 28091613, 36814597
Carcinoma Ovarian Epithelial	Stimulate	29770329
Carcinoma Pancreatic Ductal	Associate	18592007, 20556833, 21709439, 25542265, 26872370, 29973215, 30214007, 32185224, 34036383, 34925373, 34933912, 35650603, 36291742, 36912618
Carcinoma Pancreatic Ductal	Stimulate	28475017
Carcinoma Papillary	Associate	24294378
Carcinoma Renal Cell	Associate	12110091, 15220362, 15967109, 16205110, 17387348, 17482131, 17699105, 18547492, 19061835, 19077470, 19252820, 19302703, 19401348, 20032376, 20175781 View all (64 more)
Carcinoma Renal Cell	Inhibit	17505508
Carcinoma Renal Cell	Stimulate	33118406
Carcinoma Small Cell	Associate	24980293
Carcinoma Squamous Cell	Associate	16053510, 21598042, 24436242, 26985936, 29109451, 33621198, 33723932, 36187110, 37347115, 38581999
Carcinoma Squamous Cell	Stimulate	17201171, 23295589, 37445752
Cardiac Complexes Premature	Associate	37239335
Cardiomyopathies	Associate	15805230, 24444256, 25884818, 36435742
Cardiomyopathy Dilated	Associate	24444256
Cardiomyopathy Hypertrophic	Associate	30338905, 39523983
Cardiovascular Diseases	Associate	27450023, 33299319, 35069552, 35908957
Cartilage Diseases	Associate	15987493, 18050215, 22736200, 30255592
Cell Transformation Neoplastic	Associate	25396735, 29328367, 29587825, 35198082, 37838700
Cell Transformation Neoplastic	Stimulate	35413842
Central Nervous System Diseases	Associate	27701053
Cerebral Infarction	Stimulate	34708885
Cerebral Infarction	Associate	40629591
Chemical and Drug Induced Liver Injury	Associate	29106686
Chest Pain	Stimulate	25035150
Cholangiocarcinoma	Associate	16094703, 25081716, 26056085, 29953500, 35683032, 37781039, 37821935
Cholecystitis Acute	Associate	17974017
Cholesteatoma	Associate	34522167
Chondrosarcoma	Associate	15475194, 20102637, 20661931, 32469486
Chordoma	Associate	21143841
Choriocarcinoma	Associate	30140083
Choroidal Effusions	Associate	31638231
Choroidal Neovascularization	Associate	26882120, 37598400
Chronic Kidney Disease Mineral and Bone Disorder	Associate	37340541
Chronic Limb Threatening Ischemia	Associate	16414399, 24947080
Chronic Urticaria	Associate	32339669
Clubfoot	Associate	35292718
Colitis Ischemic	Stimulate	15770733
Colitis Ulcerative	Associate	12610101, 33432986, 33634990, 36461588
Colonic Neoplasms	Associate	12632503, 16294025, 18936210, 20217131, 24901645, 35902970, 36246978
Colorectal Neoplasms	Associate	12632503, 14965365, 16937436, 17016487, 17387384, 17591803, 18351386, 18648372, 19298255, 19540709, 19619276, 19843849, 19898961, 20003271, 20407014 View all (63 more)
Colorectal Neoplasms	Stimulate	18983642, 20363910, 28946548, 34421088, 35994813
Congenital heart block	Associate	18050204
Corneal Neovascularization	Associate	26727921
Coronary Artery Disease	Associate	24089028, 28444966, 28595632, 35463986
Coronary Disease	Associate	27821168, 35866783
COVID 19	Associate	33345622, 33951416, 34975885, 35069552, 35796937, 35855804, 36817449, 37347115, 39251053
Coxa Magna	Associate	17292638, 18991344
Craniopharyngioma	Associate	24608455, 36091021
Craniosynostoses	Associate	28051265
Crohn Disease	Associate	12610101, 25484075, 26802079, 27014752, 37550393
Cystic Fibrosis	Associate	21420913, 33031374
Cystitis	Associate	33146980
Death	Associate	18050204, 20544685, 24416312, 24567056, 26223692
Death	Stimulate	28824314
Dementia	Associate	19204000
Dental Caries	Associate	39343901
Depressive Disorder Major	Associate	39312335
Desmoid disease hereditary	Associate	37943631
Diabetes Gestational	Associate	33019392, 36909311
Diabetes Mellitus	Stimulate	22403299, 35285425
Diabetes Mellitus	Associate	22991450, 31214621, 32680978, 34680921, 34887659, 35841007, 35956419, 36640318, 37340541, 37365645
Diabetes Mellitus	Inhibit	31676796
Diabetes Mellitus Type 1	Associate	19691832
Diabetes Mellitus Type 2	Associate	19691832, 26600509, 28595632, 29690638, 30600310, 32851081
Diabetic Foot	Associate	34293021, 34474187, 35013299
Diabetic Foot	Inhibit	38107519
Diabetic Nephropathies	Associate	22991450, 26600509, 31214621, 34735495, 40312440
Diabetic Retinopathy	Associate	30007476, 31214621, 32290826, 33023593, 35285425
DiGeorge Syndrome	Associate	26221035
Disease	Associate	24416312
Disease	Stimulate	28365254
Disease Resistance	Associate	29393397, 30353128
Dissection Thoracic Aorta	Stimulate	28415624
Dissection Thoracic Aorta	Associate	30066903
DNA Virus Infections	Associate	23112151
Down Syndrome	Associate	37373133
Drug Related Side Effects and Adverse Reactions	Associate	20932347, 24309935, 25426963, 28028936, 28031235, 28049953, 29997451, 30320358, 32024182, 36674945, 37526979, 37905653
Drug Resistant Epilepsy	Stimulate	27061881
Duane Retraction Syndrome	Stimulate	31002820
Dupuytren Contracture	Associate	23992143
Dysbiosis	Stimulate	39456258
Edema	Associate	39533623
Emphysema	Associate	20562128
Emphysema	Stimulate	27104832
Enchondromatosis	Associate	36480544
Endocrine Gland Neoplasms	Associate	21896985
Endometrial Hyperplasia	Associate	36937462
Endometrial Neoplasms	Associate	12209691, 17099695, 20565904, 24042437, 24745019, 24918449, 25556481, 26485755, 27634881, 29673664, 30539847, 36285283, 37143105, 38458034
Endometrial Neoplasms	Stimulate	28348069, 29860279
Endometriosis	Associate	17255327, 22482968, 24796928, 26654708, 26773192, 27385728, 27939762, 28348069, 30566420, 32444257, 35012617, 38458034, 39408909
Endometriosis	Stimulate	28397725, 29860279, 36285283
Endometritis	Associate	36531509
Enterocolitis Necrotizing	Associate	26274503, 29276042, 32657204, 37239335
Eosinophilic Esophagitis	Associate	39209164
Ependymoma	Stimulate	25957288
Epilepsies Myoclonic	Associate	22812626
Epilepsy	Associate	22812626
Epilepsy Idiopathic Generalized	Stimulate	17110434
Epiretinal Membrane	Associate	17229797
Epstein Barr Virus Infections	Stimulate	32641480
Erythrocytosis Familial 2	Associate	19062180, 21993671
Escherichia coli Infections	Associate	25484075
Esophageal Neoplasms	Associate	17201171, 21945343, 27239113, 31858546, 32068233, 35484214, 35538026, 35937565
Esophageal Squamous Cell Carcinoma	Associate	12966423, 15771621, 20042640, 22200953, 25120765, 26370982, 31081089, 31556558, 31858546, 32474512, 35484214, 37938614
Esophageal Squamous Cell Carcinoma	Stimulate	17201171
Essential Hypertension	Associate	34758666
Fallopian Tube Diseases	Associate	30431105
Familial cylindromatosis	Associate	25181405
Familial Mediterranean Fever	Associate	31846428
Familial Primary Pulmonary Hypertension	Associate	20110409
Fetal Growth Retardation	Associate	22615960, 30993882, 33773574, 35837487, 38002309
Fibrocartilaginous embolism	Associate	23313531, 26735178, 29484626, 29941029, 34222486, 38305591
Fibrosarcoma	Associate	17999771
Fibrosis	Associate	22192476, 23481058, 25284705, 25618585, 26503507, 28112200, 30755787, 31422771, 34617686, 36928344, 37179298, 37446141, 37949939
Flatfoot	Associate	39533623
Fuchs' Endothelial Dystrophy	Associate	25363469
Gallbladder Neoplasms	Associate	25046749, 33067424, 37142981
Gardner Syndrome	Stimulate	33682749
Gastritis	Associate	16127019
Gastro enteropancreatic neuroendocrine tumor	Associate	24231952
Gastroesophageal Reflux	Stimulate	30057669
Gastrointestinal Neoplasms	Associate	28594907
Gastrointestinal Stromal Tumors	Associate	24133624
Gingival Overgrowth	Stimulate	25618585
Glaucoma	Associate	23042279
Glioblastoma	Associate	10691731, 16849552, 17075581, 17132220, 19291283, 19587783, 20488164, 20671264, 21084864, 21179202, 21242296, 23671189, 24075410, 24457964, 24481065 View all (25 more)
Glioblastoma	Stimulate	26339353
Glioma	Associate	11943784, 17075581, 17699105, 19359588, 20671264, 21050481, 21517260, 22700754, 23671189, 23911596, 24970694, 25758142, 26324126, 27163161, 27577073 View all (21 more)
Glioma	Stimulate	25277131, 27820599
Glioma	Inhibit	26538165
Glomerulonephritis	Associate	24577260
Glomerulonephritis IGA	Associate	32791747, 34823491
Glucocorticoid Receptor Deficiency	Associate	39526770
Glucose Metabolism Disorders	Associate	32885664
Glucosephosphate Dehydrogenase Deficiency	Associate	32630408
Glut1 Deficiency Syndrome	Associate	23671580, 32657204, 36902491
Glycogen Storage Disease Type II	Associate	24565827
Glycosuria Renal	Associate	20032376, 32767964
Granuloma	Associate	30946009
Graves Disease	Associate	29319128, 35008579
HAIR AN syndrome	Associate	19753114
Hashimoto Disease	Associate	33916948, 36807042
Haspeslagh Fryns Muelenaere syndrome	Stimulate	24715760
Head and Neck Neoplasms	Associate	16412252, 21945343, 30458787, 30642292, 35860430, 39684472
Hearing Loss Sensorineural	Associate	39526770
Heart Defects Congenital	Associate	27450023
Heart Diseases	Associate	17617866, 34612779, 36674945
Heart Failure	Associate	15951350, 23640436, 31375661, 36435742
Heart Injuries	Associate	35777901
HELLP Syndrome	Associate	37878989
Hemangioblastoma	Associate	23638216, 25310734, 31296894, 39374255
Hemangioma	Associate	22900063, 25816398, 28977119, 29268640
Hemangioma capillary infantile	Stimulate	28438094
Hemangioma capillary infantile	Associate	32094357, 32945470, 36181115
Hemangioma Cavernous Central Nervous System	Associate	28181149
Hemangiosarcoma	Associate	35979530
Hematoma Subdural Chronic	Associate	19779281
Hematuria Benign Familial	Associate	18630523
Hemochromatosis	Associate	33513852
Hemolytic Uremic Syndrome	Associate	30824757
Hemorrhagic Stroke	Stimulate	39969331
Hepatitis Autoimmune	Associate	32663496
Hepatitis B Chronic	Associate	27999186, 37490813
Hepatitis C	Associate	22986897
Hepatitis C Chronic	Associate	19846525, 36707650
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12627523, 15217513, 15677538, 30394935, 34706936, 36892943
Hereditary leiomyomatosis and renal cell cancer	Associate	19470762, 24625422, 25028521
Hernia Abdominal	Associate	32444257
Hidradenitis Suppurativa	Associate	36961533
Hippocampal Sclerosis	Associate	22812626
HIV Infections	Associate	37798121
Hodgkin Disease	Associate	33738869
Huntington Disease	Associate	36902304
Hydrocephalus	Associate	36091021
Hyperglycemia	Associate	30217067, 31214621, 31676796, 34479471
Hyperglycemia	Inhibit	31214621
Hyperglycemia	Stimulate	35088883
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25878490
Hyperoxia	Inhibit	33215223
Hyperplasia	Stimulate	17452774
Hyperplasia	Associate	19623180, 36892943, 36937462
Hypersensitivity Immediate	Stimulate	32723315
Hypertension	Associate	31599436, 32888289, 33652665, 34758666, 38002309
Hypertension Pulmonary	Associate	18411415, 20110409, 23492195, 27432037, 27811062, 32098916, 36323673
Hypertension Pulmonary	Stimulate	26414702
Hypertensive Retinopathy	Associate	31214621
Hypertrophy	Associate	28951244, 35681536
Hypertrophy Left Ventricular	Associate	31599436
Hypoglycemia	Associate	36640318
Hypoplastic Left Heart Syndrome	Stimulate	23871585
Hypothyroidism Congenital Nongoitrous 2	Associate	26914112
Hypoxia	Stimulate	10364451, 10607702, 11278891, 11494119, 11741593, 11852072, 12070140, 12086154, 12242281, 12401798, 12468553, 12764143, 12900407, 15220362, 15310764 View all (205 more)
Hypoxia	Associate	10446187, 10691731, 10699162, 10866824, 10926858, 10933058, 11676860, 11707426, 11739718, 11877282, 11943784, 11971899, 12136249, 12209691, 12354771 View all (685 more)
Hypoxia	Inhibit	25961573, 26867977, 32886165
Hypoxia Brain	Associate	10866824, 12136249, 12242281, 12401798, 12468553, 12900407, 15082527, 15104534, 15155277, 15199132, 15341671, 15379897, 15598882, 15736311, 15840558 View all (242 more)
Hypoxia Brain	Stimulate	11556841, 11852072, 12384916, 15023385, 16242072, 17663760, 18270456, 19147576, 19265129, 19542490, 19843849, 19959878, 20032407, 20151982, 20729179 View all (31 more)
Hypoxia Ischemia Brain	Associate	33997006
Idiopathic Pulmonary Fibrosis	Stimulate	27104832
Idiopathic Pulmonary Fibrosis	Associate	36656644, 37978501
IgA Vasculitis	Associate	11465705, 25289668
Ige Responsiveness Atopic	Associate	21625490
Immune dysfunction with T cell inactivation due to calcium entry defect 1	Associate	36154925
Infant Newborn Diseases	Associate	30304723
Infarction	Associate	10699162
Infections	Associate	21420913, 22178269, 23836663, 36814444
Infections	Stimulate	36482106
Infectious Mononucleosis	Associate	36154925
Inflammation	Associate	10926858, 12764056, 19390242, 19726677, 19948069, 20353560, 20354189, 20650266, 21420913, 22303451, 22355351, 23119050, 23372804, 23455892, 23604114 View all (38 more)
Inflammation	Stimulate	21502812, 26092770, 26604208, 26974319, 32980776
Inflammatory Bowel Diseases	Associate	12610101, 24301659, 25484075, 29307990, 37550393
Influenza Human	Stimulate	28536432
Insulin Resistance	Associate	26871994, 32651353, 34646087
Intervertebral Disc Degeneration	Associate	32723315, 34394829, 36814575, 37266623
Intervertebral disc disease	Associate	23991178
Intestinal Diseases	Stimulate	17179985
Intracranial Hemorrhage Hypertensive	Inhibit	21957871
Iron Deficiencies	Associate	23993337, 24120591
Iron Deficiencies	Stimulate	37087978
Ischemia	Stimulate	17511040
Ischemia	Associate	19183269, 21048961
Ischemia	Inhibit	23456821
Joint Diseases	Stimulate	21163925
Keloid	Associate	25777304, 36316928
Keratitis	Associate	28573109
Keratoconus	Associate	31467338, 32886165
Kidney Diseases	Associate	23481058
Kidney Diseases	Stimulate	28181420
Kidney Failure Chronic	Associate	35908957
Kidney Neoplasms	Associate	21233420, 21386837, 23449350, 24625422, 26743088, 30832444, 32586940, 34494499
Klatskin Tumor	Associate	26657503
Laryngeal Neoplasms	Associate	21227008, 24083758, 24677746, 25412955, 36469955
Laryngitis	Associate	24980293
Leigh syndrome French Canadian type	Associate	30995105
Leiomyoma	Associate	34942165, 35377824
Lesch Nyhan Syndrome	Associate	34421088
Leukemia	Associate	20166137, 21880716, 22948410, 24016597
Leukemia Lymphocytic Chronic B Cell	Stimulate	15558070
Leukemia Lymphocytic Chronic B Cell	Associate	19336759, 20018914
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23965958, 30045750, 35528614, 36195570
Leukemia Myeloid	Associate	18728026
Leukemia Myeloid Acute	Associate	18728026, 22948410, 24641416, 24966925, 26218201, 27082496, 30909668, 34895042, 37807875, 39343915
Leukemia Myeloid Acute	Stimulate	27002764
Leukemia Myeloid Acute	Inhibit	39993966
Leukemia T Cell	Associate	24223100
Leukoencephalopathies	Associate	12764056, 37239335
Leukoencephalopathy Progressive Multifocal	Associate	19360424
Leukoplakia Oral	Associate	33723932
Leydig Cell Tumor	Associate	34009721
Lichen Planus Oral	Associate	36450755, 37629739
Livedoid Vasculopathy	Associate	35204817
Liver Cirrhosis	Associate	28112200, 33673041
Low Back Pain	Associate	32723315
Lung Diseases	Associate	15113858, 21420913, 23492195, 27245780, 32098916, 33810600, 35259405
Lung Diseases Interstitial	Associate	33178179
Lung Injury	Associate	12493066
Lung Neoplasms	Stimulate	17699846
Lung Neoplasms	Associate	19176399, 19305150, 19546348, 22349311, 22467238, 23295589, 25460312, 25813626, 26035432, 26508030, 26548300, 27708247, 28028936, 28423489, 28537679 View all (16 more)
Lupus Erythematosus Cutaneous	Associate	37526979
Lupus Nephritis	Associate	32085620, 37526979
Lymphatic Metastasis	Stimulate	12966423, 17461470, 32473641
Lymphatic Metastasis	Associate	16251878, 18630523, 19305150, 20217131, 20953377, 21330825, 21778301, 23012449, 23545606, 23927384, 23935399, 24427353, 25081716, 25119596, 25120765 View all (14 more)
Lymphatic Metastasis	Inhibit	21213129
Lymphedema	Stimulate	30431105
Lymphoma	Associate	30065361, 32533646
Lymphoma AIDS Related	Associate	27701053
Lymphoma Follicular	Associate	18422776
Lymphoma Large B Cell Diffuse	Associate	20048181, 24312289, 34708297
Lymphoma Non Hodgkin	Associate	24033233, 24086384, 37400829
Lymphoma Primary Effusion	Associate	17634230, 23221556, 28922425
Lysosomal Storage Diseases	Associate	36748335
Macrophage Activation Syndrome	Associate	24301659, 39292770
Macular Degeneration	Associate	31226340
Malaria Cerebral	Associate	30638864
Malformations of Cortical Development Group I	Associate	25231392
Malformations of Cortical Development Group III	Stimulate	26414702
Malnutrition	Inhibit	26646563
Mammary Neoplasms Animal	Associate	24015760
Medulloblastoma	Associate	30227871, 30320358
Melanoma	Associate	16396931, 19794965, 19934275, 20668552, 21233846, 23275444, 23474946, 26221040, 26375488, 26547841, 26787841, 27042054, 27542908, 28257048, 28339028 View all (8 more)
Melanoma	Stimulate	19919690
Meningioma	Associate	23877362, 32705667, 32908869
Mesothelioma	Associate	26544728, 36656861
Mesothelioma Malignant	Associate	23879962, 26544728, 30111297
Metabolic Diseases	Associate	17325032, 25956355, 39209164
Metabolic Syndrome	Associate	22039494, 34410257
Metaplasia	Stimulate	17429140
Microsatellite Instability	Associate	34421088
Microvascular Angina	Associate	37390241
Mitochondrial Diseases	Associate	19846525, 20885442, 22216344, 25460312, 25833255, 28426671, 32096549
Mitochondrial Diseases	Inhibit	36973679
Mitochondrial Encephalomyopathies	Associate	33655764
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	23492775
Mohr Tranebjaerg syndrome	Associate	32432742
Mouth Neoplasms	Associate	15901372, 25105148, 31711427, 32255193, 34318593
Mucocutaneous Lymph Node Syndrome	Associate	32808647
Mucopolysaccharidosis II	Associate	24083598
Multiple Myeloma	Associate	16234364, 17848618, 21223249, 24732040, 26867162, 27340936, 28008160, 28509582, 29882856, 30353128, 32714991, 35081971
Multiple Sclerosis	Associate	32192527
Muscle Neoplasms	Associate	38104132
Muscular Atrophy	Inhibit	35806119
Muscular Atrophy	Stimulate	36125902
Muscular Dystrophy Duchenne	Stimulate	21574524
Muscular Dystrophy Duchenne	Associate	36619896
Muscular Dystrophy Facioscapulohumeral	Associate	38104132
Myelodysplastic Syndromes	Associate	31411003, 33921064
Myelodysplastic Syndromes	Stimulate	35642674
Myocardial Infarction	Associate	24089028, 32399898, 35378513
Myocardial Ischemia	Associate	10699162, 12914934, 15770733, 16973622
Myocarditis	Associate	34465337
Myopathies Structural Congenital	Associate	32586940
Myopathies Structural Congenital	Stimulate	36453544
Myopathy with Giant Abnormal Mitochondria	Associate	18172210, 29596470
Nasal Polyps	Stimulate	32673430
Nasopharyngeal Carcinoma	Associate	22587416, 22952803, 23228635, 24662828, 25377659, 31782911, 32432742, 32679194, 33099941, 33725777, 36541519
Necrosis	Associate	12759237, 16080559, 17075581, 18351386, 20565904, 20637078, 23640464, 27629849, 28474313
Necrosis	Stimulate	30943919
Nemaline myopathy 5	Associate	16035955
Neoplasm Invasiveness	Stimulate	15786555
Neoplasm Metastasis	Associate	12627523, 15084243, 15623945, 15771621, 15802864, 16080559, 16205110, 16511565, 16929169, 18062927, 18172210, 18528739, 19251694, 19307182, 19390242 View all (128 more)
Neoplasm Metastasis	Stimulate	12966423, 20544684, 23257898, 27448695, 27634881, 28824314, 35042744
Neoplasm Metastasis	Inhibit	23342109
Neoplasm Recurrence Local	Associate	25596110
Neoplasm Residual	Associate	25700369
Neoplasms	Associate	10364451, 11676860, 11943784, 11986208, 12070140, 12086154, 12242281, 12429530, 12627523, 12671706, 12761217, 12966423, 14580258, 14604972, 15084243 View all (507 more)
Neoplasms	Inhibit	16083877, 20032376, 21386837, 26538165, 27244880, 27341002, 29899167, 33052979
Neoplasms	Stimulate	17099695, 18294286, 19808899, 20003191, 20978319, 22542128, 22986897, 23723999, 23977378, 24457463, 24804733, 26873439, 28102487, 28169245, 28474313 View all (7 more)
Neoplasms Adipose Tissue	Associate	34728615
Neoplasms Basal Cell	Stimulate	29085834
Neoplasms Cystic Mucinous and Serous	Stimulate	29085834
Neoplasms Glandular and Epithelial	Associate	36928344, 39209164, 39307374
Neoplasms Squamous Cell	Associate	19096126, 25412955, 30458787, 31556558, 34642392
Neoplasms Unknown Primary	Associate	21598042
Neoplasms Vascular Tissue	Associate	36147560
Nephrotic Syndrome	Associate	37478256
Nerve Degeneration	Associate	35987203, 37324938
Neuroblastoma	Associate	12239177, 22363512, 23563563, 25630799, 25912138, 26057707, 27824082, 28590414, 29117193, 30808328, 35942521, 39632332
Neurodegenerative Diseases	Associate	33383341
Neuroendocrine Tumors	Associate	27994516
Neurofibroma Plexiform	Stimulate	21703400
Neurofibrosarcoma	Associate	24824755, 25833823, 28558056
Neuroinflammatory Diseases	Associate	36674945
Neutrophil Actin Dysfunction	Associate	24565827
Non Muscle Invasive Bladder Neoplasms	Stimulate	34080067
Non Muscle Invasive Bladder Neoplasms	Associate	35879690, 37240301
Obesity	Associate	17591803, 30409902, 30868903, 31935962, 33758342
Obesity	Stimulate	36961533
Obesity Maternal	Associate	18980686
Obesity Maternal	Inhibit	24484739
Occipital horn syndrome	Stimulate	33758342
Oculocutaneous albinism type 2	Associate	17099695
Oculocutaneous albinism type 2	Stimulate	32723315
Odontogenic Cysts	Associate	31319505, 31424999, 36479894
Oncocytoma renal	Associate	30728892
Oncogene Addiction	Stimulate	12070140
Oncogene Addiction	Associate	23746844
Optic Atrophy	Associate	37946484
Optic Neuropathy Ischemic	Associate	24444256
Oral Submucous Fibrosis	Stimulate	28365254
Oral Submucous Fibrosis	Associate	35381759, 36308177
Ossification of Posterior Longitudinal Ligament	Associate	40613289
Osteitis Deformans	Associate	19925894
Osteoarthritis	Inhibit	11465705
Osteoarthritis	Associate	12823854, 15987493, 22249478, 23965235, 26559024, 30081074, 32072994, 32572904, 33430025, 33629290, 35887269, 36281111
Osteoarthritis	Stimulate	31055848, 32476580
Osteoarthritis Knee	Associate	26293784, 39796139
Osteoarthritis Knee	Stimulate	30755787, 40211184
Osteochondritis	Associate	33729061
Osteoglophonic dwarfism	Inhibit	23456821
Osteoglophonic dwarfism	Stimulate	36496986
Osteoglophonic dwarfism	Associate	37324938
Osteomas Of Mandible	Associate	25700369
Osteoporosis	Associate	29745905, 35069454, 36147560
Osteosarcoma	Associate	18528739, 24618817, 25884381, 27662380, 29328452, 29739381, 31866584, 31930127, 32802732, 35729160, 36438897, 38297292
Ovarian Diseases	Associate	15337760, 16294025, 26205780, 28348069
Ovarian Neoplasms	Associate	12023962, 14507651, 15337760, 17110434, 19014607, 21964756, 22336585, 23437196, 23545606, 25491408, 25975373, 26261517, 26548925, 26801746, 27166196 View all (25 more)
Ovarian Neoplasms	Stimulate	17532031, 31175269
Pancreatic Neoplasms	Associate	12937141, 15558070, 17968710, 18592007, 18607542, 19414389, 19671674, 20037603, 21709439, 21887310, 22970168, 23377827, 23726431, 23740244, 24002598 View all (28 more)
Pancreatic Neoplasms	Stimulate	31584877
Pancreatitis	Associate	25888489
Papillary Thyroid Microcarcinoma	Associate	27936049
Papilloma Choroid Plexus	Associate	32192527
Papillomavirus Infections	Associate	33587450
Paraganglioma	Associate	23889685
Parkinson Disease	Associate	26768367, 36674945
Pelvic Organ Prolapse	Associate	29230415, 29578197, 30504760
Periodic fever familial autosomal dominant	Associate	30222022, 30563869, 33178179
Periodontal Diseases	Associate	27058371
Periodontitis	Associate	25861162, 33231338
Periodontitis	Stimulate	27058371
Peripheral Arterial Disease	Associate	24657063, 29843956
Peritonitis	Stimulate	17094412
Personality Disorders	Associate	17099695, 17452774, 20565904, 22258474, 22424533
Phyllodes Tumor	Associate	16168127, 22986897
Placenta Diseases	Associate	29626597, 32114885
Pneumonia	Associate	35259405
Pneumothorax	Associate	20526373
Polycystic Ovary Syndrome	Associate	31327131, 32096549, 35528524, 36151730
Polycystic Ovary Syndrome	Inhibit	34360981
Polycythemia	Associate	14521712, 31001558, 32755251, 34680921, 38244120
Polyposis Syndrome Hereditary Mixed 1	Stimulate	18351386
Polyps	Associate	28051265
Post Acute COVID 19 Syndrome	Associate	36890149
Pre Eclampsia	Associate	22615960, 30140083, 31477211, 33236147, 36686428, 37878989, 38002309, 39885406
Pre Eclampsia	Stimulate	22840297, 36160709
Precancerous Conditions	Stimulate	15271983, 37713813
Precancerous Conditions	Associate	31793175, 33819917
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22948410, 35603962
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	20729179
Premature Birth	Associate	23068965
Primary Graft Dysfunction	Associate	17617866
Primary Myelofibrosis	Inhibit	26408680
Prodromal Symptoms	Associate	24427353
Prolapse	Stimulate	29578197
Prostate cancer familial	Associate	25884381
Prostatic Neoplasms	Associate	12136249, 12401798, 15623945, 16205110, 16884534, 16886625, 18285700, 18563715, 18682687, 19101986, 19106642, 19151763, 19211554, 19244104, 20303950 View all (54 more)
Prostatic Neoplasms	Stimulate	23977378, 27448695
Prostatic Neoplasms Castration Resistant	Associate	12136249, 16205110, 23342109, 24464861, 25829060, 31748715, 35931888
Prostatitis	Associate	12136249, 20303950, 21712410, 23342109, 23594994, 24504474, 35672281, 36308177
Pseudomonas Infections	Associate	21420913
Psoriasis	Associate	36961533
Pterygium	Associate	24715760, 32753832, 37684398
Pulmonary Arterial Hypertension	Associate	21258008, 23509326, 36072642
Pulmonary Arterial Hypertension	Inhibit	27811062
Pulmonary Atelectasis	Associate	33977755
Pulmonary Disease Chronic Obstructive	Inhibit	20562128, 22172637, 22383663
Pulmonary Disease Chronic Obstructive	Associate	21557221, 25565795, 26782374, 27163696, 28865600, 29339421, 30280794, 30538441, 30575333, 32099002, 33469280, 34258270, 35609226, 35634326, 35637927 View all (5 more)
Pulmonary Disease Chronic Obstructive	Stimulate	29695901, 32921997
Pulmonary edema of mountaineers	Stimulate	14555664
Pulmonary edema of mountaineers	Associate	27210110, 31001558
Pulmonary edema of mountaineers	Inhibit	37002243
Pulmonary Embolism	Associate	31204374
Pulpitis	Associate	35979583, 39343901
Purpura Thrombocytopenic Idiopathic	Associate	40534165
Pyruvate Dehydrogenase Complex Deficiency Disease	Associate	21846590
Radiation Pneumonitis	Associate	34964782
Raynaud Disease	Associate	29991707
Rectal Neoplasms	Associate	17016487, 19436307, 22104271, 22531693, 24374863, 26617778, 27966740, 34108073
Recurrence	Associate	25596110
Renal Insufficiency	Associate	36209090
Renal Insufficiency Chronic	Associate	23481058, 28819298, 34617686
Renal Insufficiency Chronic	Stimulate	28181420
Reperfusion Injury	Stimulate	33241954
Reperfusion Injury	Associate	36819784
Respiration Disorders	Associate	30728892
Respiratory Distress Syndrome	Associate	37239335
Respiratory Tract Diseases	Associate	33951416
Respiratory Tract Infections	Associate	22977664, 28638274
Retinal Diseases	Stimulate	24859386
Retinal Diseases	Associate	28243027
Retinal Dysplasia	Associate	12759237, 17179985, 30840126
Retinoblastoma	Associate	20860824, 24338218, 29243776, 35253975, 36741966
Retinopathy of Prematurity	Associate	40084286
Retroperitoneal Neoplasms	Associate	20026900
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	29641463
Rheumatic Diseases	Associate	28383556
Rhinitis Allergic	Associate	28051265, 37793334
Sarcoidosis	Inhibit	23181555
Sarcoidosis	Associate	30946009
Sarcoma	Associate	20026900, 24927770, 25965573, 30513863
Sarcoma Ewing	Associate	20442286, 20637078, 23579072, 33682749
Sarcoma Kaposi	Associate	23221556, 26092770, 33789996, 37909728
Sarcopenia	Inhibit	35806119
Scleroderma Systemic	Stimulate	29991707
Sepsis	Associate	26917434, 35090526, 37047205
Severe Acute Respiratory Syndrome	Associate	33634990
Sexual Dysfunction Physiological	Associate	25046749
Shock	Associate	19279559, 22781303
Sinusitis	Associate	24840724, 28051265
Sjogren's Syndrome	Associate	28484714
Skin Diseases	Associate	37526979
Sleep Apnea Obstructive	Stimulate	27754829, 29997451, 30669593, 32663129, 32896931
Sleep Apnea Obstructive	Associate	30600310, 31116583, 33737411, 34667186, 39940739
Sleep Apnea Syndromes	Associate	34446064
Sleep Disorders Circadian Rhythm	Associate	32939054
Sleep Initiation and Maintenance Disorders	Associate	34174759
Small Cell Lung Carcinoma	Associate	20003295, 22258474, 23295589, 25695729, 28824314, 35641209
Smoke Inhalation Injury	Stimulate	36961533
Smooth Muscle Tumor	Associate	37415103
Spinal Cord Injuries	Associate	36221378
Squamous Cell Carcinoma of Head and Neck	Associate	15901372, 16035955, 16205110, 18630523, 19293442, 19568272, 20544685, 20622897, 22348829, 23028863, 23699668, 23920275, 24416312, 25421331, 25816356 View all (27 more)
Squamous Cell Carcinoma of Head and Neck	Inhibit	26228921
ST Elevation Myocardial Infarction	Associate	35751950
Stomach Diseases	Associate	28401064, 31001558
Stomach Neoplasms	Associate	17461470, 17519536, 17953712, 18381294, 18452596, 19223895, 19287200, 20491781, 20559021, 20706634, 20829524, 20845004, 22754381, 23364970, 23445622 View all (35 more)
Stomach Neoplasms	Inhibit	29899167
Stomach Neoplasms	Stimulate	30226558, 31057297
Stroke	Associate	22167233, 32506171, 37324938
Stroke	Stimulate	39969331
Sudden Unexpected Death in Epilepsy	Associate	22812626
Systemic Inflammatory Response Syndrome	Associate	38166916
Tachycardia Atrioventricular Nodal Reentry	Associate	34060285
Tarlov Cysts	Associate	35088883
Taste Disorders	Associate	34069294
Telangiectasia Hereditary Hemorrhagic	Associate	35393474, 37689549
Temporomandibular Joint Disorders	Associate	26239269
Tertiary Lymphoid Structures	Associate	12627523, 20003271, 20953377, 21227008, 27173353, 31577739
Tertiary Lymphoid Structures	Stimulate	23059773
Tetralogy of Fallot	Associate	23032507, 23770788, 31422771, 34521346
Thecoma	Associate	27035330
Thinness	Associate	37446376
Thrombophilia	Associate	31263845
Thrombosis	Associate	24294378, 26598923, 26910835
Thymoma	Associate	26254278, 34219124
Thymus Neoplasms	Associate	26254278
Thyroid cancer follicular	Associate	28474313
Thyroid Cancer Papillary	Associate	20473281, 24427353, 26846782, 31378898, 36329448, 36897686, 37198319, 39273308, 40598215
Thyroid Carcinoma Anaplastic	Associate	27487122
Thyroid Diseases	Associate	29084538
Thyroid Neoplasms	Associate	19808899, 23824493, 26756227, 29084538, 30367082, 30768848, 36428988, 37036874
Tooth Resorption	Associate	25700369
Transposition of Great Vessels	Associate	20846364
Triple Negative Breast Neoplasms	Associate	22937154, 25356777, 27303043, 31577739, 33918859, 34779768, 34791795, 35338412, 35703312, 35867755, 35985176, 36822023, 36939902, 37681672, 37713894, 38081808, 38179762 View all (2 more)
Triple Negative Breast Neoplasms	Stimulate	35268073
Tuberculosis Meningeal	Associate	27245780
Tuberculosis Multidrug Resistant	Associate	20217131, 24083758, 24901645, 25040744, 25310259, 26292288, 27249600, 30939201
Tuberculosis Multidrug Resistant	Stimulate	23593363
Ulcer	Associate	37365645
Uremia	Associate	37773677
Urethral Neoplasms	Associate	36637036
Urinary Bladder Neoplasms	Associate	24737584, 24937673, 25266796, 26541358, 27542232, 27835695, 30315244, 30475758, 30786690, 32382009, 33681390, 33991457, 34080067, 36327483, 37813876, 40594164 View all (1 more)
Uterine Cervical Neoplasms	Stimulate	19574782
Uterine Cervical Neoplasms	Associate	21213129, 21330825, 23927384, 24551277, 26464645, 27220494, 27492148, 27593081, 29207048, 29271989, 29654110, 30530968, 31350968, 32319576, 33099935 View all (7 more)
Uterine Cervicitis	Associate	25401740
Uterine Diseases	Associate	36937462
Uveal melanoma	Associate	25166211, 31765784
Varicocele	Associate	36372090
Varicose Veins	Associate	22277691
Vascular Diseases	Associate	31089163, 34479471, 35666067
Vascular System Injuries	Associate	34479471
Venous Insufficiency	Stimulate	29626597
Venous Thromboembolism	Stimulate	34381164
Venous Thrombosis	Associate	37466160, 39969342
Ventricular Dysfunction Right	Associate	31422771
Ventricular Remodeling	Associate	23032507, 23492195, 23871585
Virus Diseases	Inhibit	33721728
Vitiligo	Stimulate	31885781, 35222802
Vocal Cord Paralysis	Associate	30840126
von Hippel Lindau Disease	Associate	11744734, 14521712, 16507982, 17532031, 17989922, 18836991, 21778301, 25093297, 27287256, 30728892, 34135317, 39374255
von Hippel Lindau Disease	Inhibit	12468553, 14965365, 16396931, 19483472, 22094876, 32586940
von Hippel Lindau Disease	Stimulate	15220362, 20980436
Wilms Tumor	Associate	21910893
Wounds and Injuries	Associate	32476580, 36947400
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Associate	31116583

HIF1A (hypoxia inducible factor 1 subunit alpha)