Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3090
Gene name Gene Name - the full gene name approved by the HGNC.
HIC ZBTB transcriptional repressor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HIC1
Synonyms (NCBI Gene) Gene synonyms aliases
ZBTB29, ZNF901, hic-1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene resul
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017725 hsa-miR-335-5p Microarray 18185580
MIRT487226 hsa-miR-4781-5p PAR-CLIP 23592263
MIRT286071 hsa-miR-6777-5p PAR-CLIP 23592263
MIRT286073 hsa-miR-6889-5p PAR-CLIP 23592263
MIRT487224 hsa-miR-1913 PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 19491197
SIRT1 Unknown 22510409
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12052894, 15231840
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603825 4909 ENSG00000177374
Protein
UniProt ID Q14526
Protein name Hypermethylated in cancer 1 protein (Hic-1) (Zinc finger and BTB domain-containing protein 29)
Protein function Transcriptional repressor (PubMed:12052894, PubMed:15231840). Recognizes and binds to the consensus sequence '5-[CG]NG[CG]GGGCA[CA]CC-3' (PubMed:15231840). May act as a tumor suppressor (PubMed:20154726). Involved in development of head, face, l
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 37 153 BTB/POZ domain Domain
PF00096 zf-C2H2 507 529 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 535 557 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 563 585 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 591 613 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
Sequence
MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GAEPSLGAVLAAASYLQIPDLVALCKKRLKRHG
KYCHLRGGGGGGGGYAPYGRPGRGLRA
ATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLC
GLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERG
GDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSH
LGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMH
AVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT
Sequence length 733
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of transcription factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenomatous Polyps Associate 22020530
Bone Neoplasms Associate 23199169
Breast Neoplasms Associate 11747329, 19015639, 19819984, 22184117, 22194601, 31795965
Breast Neoplasms Inhibit 24489730
Calcinosis Cutis Stimulate 23199169
Calcinosis Cutis Associate 28708932
Carcinogenesis Associate 19525223, 27449031
Carcinoma Hepatocellular Associate 19491197
Carcinoma Renal Cell Associate 37388742
CD59 Deficiency Associate 29466736