Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3090
Gene name Gene Name - the full gene name approved by the HGNC.	HIC ZBTB transcriptional repressor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HIC1
Synonyms (NCBI Gene) Gene synonyms aliases	ZBTB29, ZNF901, hic-1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene resul

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017725	hsa-miR-335-5p	Microarray	18185580
MIRT487226	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT286071	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT286073	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487224	hsa-miR-1913	PAR-CLIP	23592263
MIRT487223	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT487222	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT487221	hsa-miR-4706	PAR-CLIP	23592263
MIRT487220	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT286061	hsa-miR-3175	PAR-CLIP	23592263
MIRT727501	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727500	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT487226	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT286071	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT286073	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487224	hsa-miR-1913	PAR-CLIP	23592263
MIRT487223	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT487222	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT487221	hsa-miR-4706	PAR-CLIP	23592263
MIRT487220	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT286061	hsa-miR-3175	PAR-CLIP	23592263
MIRT1045337	hsa-miR-128	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT1045339	hsa-miR-1299	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045340	hsa-miR-27a	CLIP-seq
MIRT1045341	hsa-miR-27b	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045343	hsa-miR-3177-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT1045347	hsa-miR-4506	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045350	hsa-miR-513a-5p	CLIP-seq
MIRT1045351	hsa-miR-580	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT1045353	hsa-miR-7	CLIP-seq
MIRT1045354	hsa-miR-760	CLIP-seq
MIRT1045355	hsa-miR-875-3p	CLIP-seq
MIRT1045356	hsa-miR-1910	CLIP-seq
MIRT1045357	hsa-miR-19a	CLIP-seq
MIRT1045358	hsa-miR-19b	CLIP-seq
MIRT1045359	hsa-miR-23a	CLIP-seq
MIRT1045360	hsa-miR-23b	CLIP-seq
MIRT1045361	hsa-miR-23c	CLIP-seq
MIRT1045362	hsa-miR-361-5p	CLIP-seq
MIRT1045363	hsa-miR-3662	CLIP-seq
MIRT1045364	hsa-miR-3915	CLIP-seq
MIRT1045365	hsa-miR-3928	CLIP-seq
MIRT1045366	hsa-miR-4252	CLIP-seq
MIRT1045367	hsa-miR-4449	CLIP-seq
MIRT1045368	hsa-miR-455-3p	CLIP-seq
MIRT1045369	hsa-miR-4698	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT2009969	hsa-miR-661	CLIP-seq
MIRT1045356	hsa-miR-1910	CLIP-seq
MIRT1045368	hsa-miR-455-3p	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT2437587	hsa-miR-2278	CLIP-seq
MIRT1045364	hsa-miR-3915	CLIP-seq
MIRT1045365	hsa-miR-3928	CLIP-seq
MIRT2437588	hsa-miR-4728-5p	CLIP-seq
MIRT2437589	hsa-miR-503	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
E2F1	Activation	19491197
SIRT1	Unknown	22510409

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12052894, 15231840
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15231840
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15231840
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7585125
GO:0005515	Function	Protein binding	IPI	12052894, 16724116, 16762039, 19486893
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	TAS	7585125
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007275	Process	Multicellular organism development	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	16269335
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	16724116
GO:0042826	Function	Histone deacetylase binding	IDA	12052894
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	15231840
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
603825	4909	ENSG00000177374

Protein

UniProt ID

Q14526

Protein name

Hypermethylated in cancer 1 protein (Hic-1) (Zinc finger and BTB domain-containing protein 29)

Protein function

Transcriptional repressor (PubMed:12052894, PubMed:15231840). Recognizes and binds to the consensus sequence '5-[CG]NG[CG]GGGCA[CA]CC-3' (PubMed:15231840). May act as a tumor suppressor (PubMed:20154726). Involved in development of head, face, l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	37 → 153	BTB/POZ domain	Domain
PF00096	zf-C2H2	507 → 529	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	535 → 557	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	563 → 585	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	591 → 613	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.

Sequence

MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRA
ATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLC
GLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERG
GDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT

Sequence length

733

Interactions

View interactions

	Reactome
			SUMOylation of transcription factors

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	20154726
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	20154726
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Lissencephaly	Lissencephaly	rs137853043, rs137853044, rs137853045, rs137853046, rs137853047, rs137853048, rs137853049, rs137853050, rs121434482, rs121434483, rs1567561137, rs121434485, rs121434486, rs121434487, rs121434489 View all (183 more)
Age-related macular degeneration	Age related macular degeneration	rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152 View all (20 more)	30742112
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	20154726
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	18347096

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Hypertension	Hypertension	GWAS

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenomatous Polyps	Associate	22020530
Bone Neoplasms	Associate	23199169
Breast Neoplasms	Associate	11747329, 19015639, 19819984, 22184117, 22194601, 31795965
Breast Neoplasms	Inhibit	24489730
Calcinosis Cutis	Stimulate	23199169
Calcinosis Cutis	Associate	28708932
Carcinogenesis	Associate	19525223, 27449031
Carcinoma Hepatocellular	Associate	19491197
Carcinoma Renal Cell	Associate	37388742
CD59 Deficiency	Associate	29466736
Chordoma	Associate	23533570
Choriocarcinoma	Associate	15507671
Colitis Ulcerative	Associate	21274674
Colorectal Neoplasms	Associate	21274674, 22020530, 27540971, 28708932
Diabetic Nephropathies	Associate	34732690
Esophageal Squamous Cell Carcinoma	Associate	26510908
Hydatidiform Mole	Associate	15507671
Laryngeal Neoplasms	Associate	34299935
Leukemia Myeloid Acute	Associate	34207065, 35995769
Leukemia Promyelocytic Acute	Associate	18318772
Lymphatic Metastasis	Inhibit	26510908
Neoplasm Metastasis	Associate	22194601, 26510908
Neoplasms	Associate	15389252, 20546602, 20676143, 22140553, 22184117, 24489730, 27540971, 27793057, 28708932, 29133799, 31795965, 32494608, 34299935, 37388742
Neoplasms	Inhibit	18318772, 19015639, 19491197, 19525223, 19819984, 21274674, 22194601, 24067369, 24252461, 26510908, 27449031, 27935866, 32457453, 35787399, 9374372
Neoplasms Germ Cell and Embryonal	Associate	15149548
Neuroblastoma	Associate	20546602
Non Muscle Invasive Bladder Neoplasms	Associate	24252461
Nonseminomatous germ cell tumor	Associate	12495446
Osteosarcoma	Associate	19525223
Ovarian Neoplasms	Associate	11238060, 18757082
Polyposis Syndrome Hereditary Mixed 1	Associate	18313025
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	18318772
Sarcoma	Associate	37388742
Stomach Neoplasms	Inhibit	21533545
Thyroid Cancer Papillary	Associate	27793057
Thyroid Neoplasms	Inhibit	27793057
Triple Negative Breast Neoplasms	Associate	25068292
Urinary Bladder Neoplasms	Associate	22140553
Uterine Cervical Dysplasia	Associate	12773202
Uterine Cervical Neoplasms	Associate	12773202
Uveal melanoma	Inhibit	27449031
Wilms Tumor	Associate	35436013

HIC1 (HIC ZBTB transcriptional repressor 1)