Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3090
Gene name	HIC ZBTB transcriptional repressor 1
Gene symbol	HIC1
Synonyms (NCBI Gene)	ZBTB29ZNF901hic-1
Chromosome	17
Chromosome location	17p13.3
Summary	This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene resul

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017725	hsa-miR-335-5p	Microarray	18185580
MIRT487226	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT286071	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT286073	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487224	hsa-miR-1913	PAR-CLIP	23592263
MIRT487223	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT487222	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT487221	hsa-miR-4706	PAR-CLIP	23592263
MIRT487220	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT286061	hsa-miR-3175	PAR-CLIP	23592263
MIRT727501	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727500	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT487226	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT286071	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT286073	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487224	hsa-miR-1913	PAR-CLIP	23592263
MIRT487223	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT487222	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT487221	hsa-miR-4706	PAR-CLIP	23592263
MIRT487220	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT286061	hsa-miR-3175	PAR-CLIP	23592263
MIRT1045337	hsa-miR-128	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT1045339	hsa-miR-1299	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045340	hsa-miR-27a	CLIP-seq
MIRT1045341	hsa-miR-27b	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045343	hsa-miR-3177-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT1045347	hsa-miR-4506	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045350	hsa-miR-513a-5p	CLIP-seq
MIRT1045351	hsa-miR-580	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT1045353	hsa-miR-7	CLIP-seq
MIRT1045354	hsa-miR-760	CLIP-seq
MIRT1045355	hsa-miR-875-3p	CLIP-seq
MIRT1045356	hsa-miR-1910	CLIP-seq
MIRT1045357	hsa-miR-19a	CLIP-seq
MIRT1045358	hsa-miR-19b	CLIP-seq
MIRT1045359	hsa-miR-23a	CLIP-seq
MIRT1045360	hsa-miR-23b	CLIP-seq
MIRT1045361	hsa-miR-23c	CLIP-seq
MIRT1045362	hsa-miR-361-5p	CLIP-seq
MIRT1045363	hsa-miR-3662	CLIP-seq
MIRT1045364	hsa-miR-3915	CLIP-seq
MIRT1045365	hsa-miR-3928	CLIP-seq
MIRT1045366	hsa-miR-4252	CLIP-seq
MIRT1045367	hsa-miR-4449	CLIP-seq
MIRT1045368	hsa-miR-455-3p	CLIP-seq
MIRT1045369	hsa-miR-4698	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT2009969	hsa-miR-661	CLIP-seq
MIRT1045356	hsa-miR-1910	CLIP-seq
MIRT1045368	hsa-miR-455-3p	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT1045338	hsa-miR-1291	CLIP-seq
MIRT739487	hsa-miR-1539	CLIP-seq
MIRT1045342	hsa-miR-3173-5p	CLIP-seq
MIRT1045344	hsa-miR-342-5p	CLIP-seq
MIRT1045345	hsa-miR-4292	CLIP-seq
MIRT1045346	hsa-miR-4308	CLIP-seq
MIRT739485	hsa-miR-4632	CLIP-seq
MIRT1045348	hsa-miR-4651	CLIP-seq
MIRT1045349	hsa-miR-4664-5p	CLIP-seq
MIRT739486	hsa-miR-4783-5p	CLIP-seq
MIRT1045352	hsa-miR-608	CLIP-seq
MIRT2437587	hsa-miR-2278	CLIP-seq
MIRT1045364	hsa-miR-3915	CLIP-seq
MIRT1045365	hsa-miR-3928	CLIP-seq
MIRT2437588	hsa-miR-4728-5p	CLIP-seq
MIRT2437589	hsa-miR-503	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
E2F1	Activation	19491197
SIRT1	Unknown	22510409

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12052894, 15231840
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15231840
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15231840
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7585125
GO:0005515	Function	Protein binding	IPI	12052894, 16724116, 16762039, 19486893
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	7585125
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	16269335
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	16724116
GO:0042826	Function	Histone deacetylase binding	IDA	12052894
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	15231840
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
603825	4909	ENSG00000177374

Q14526

Protein name

Hypermethylated in cancer 1 protein (Hic-1) (Zinc finger and BTB domain-containing protein 29)

Protein function

Transcriptional repressor (PubMed:12052894, PubMed:15231840). Recognizes and binds to the consensus sequence '5-[CG]NG[CG]GGGCA[CA]CC-3' (PubMed:15231840). May act as a tumor suppressor (PubMed:20154726). Involved in development of head, face, l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	37 → 153	BTB/POZ domain	Domain
PF00096	zf-C2H2	507 → 529	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	535 → 557	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	563 → 585	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	591 → 613	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.

Sequence

MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRA
ATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLC
GLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERG
GDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT

Sequence length

733

Interactions

View interactions

	Reactome
			SUMOylation of transcription factors

HIC1 (HIC ZBTB transcriptional repressor 1)