Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3087
Gene name Gene Name - the full gene name approved by the HGNC.
Hematopoietically expressed homeobox
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HHEX
Synonyms (NCBI Gene) Gene synonyms aliases
HEX, HMPH, HOX11L-PEN, PRH, PRHX
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020132 hsa-miR-130b-3p Sequencing 20371350
MIRT031099 hsa-miR-19b-3p Sequencing 20371350
MIRT1045002 hsa-miR-130a CLIP-seq
MIRT1045003 hsa-miR-130b CLIP-seq
MIRT1045004 hsa-miR-19a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IC 18713067
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10871399, 15016828
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 18755198
GO:0000976 Function Transcription cis-regulatory region binding TAS 19324893
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604420 4901 ENSG00000152804
Protein
UniProt ID Q03014
Protein name Hematopoietically-expressed homeobox protein HHEX (Homeobox protein HEX) (Homeobox protein PRH) (Proline-rich homeodomain protein)
Protein function Recognizes the DNA sequence 5'-ATTAA-3' (By similarity). Transcriptional repressor (By similarity). Activator of WNT-mediated transcription in conjunction with CTNNB1 (PubMed:20028982). Establishes anterior identity at two levels; acts early to
PDB 2E1O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 138 194 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Liver and promyelocytic leukemia cell line HL-60. {ECO:0000269|PubMed:1360645, ECO:0000269|PubMed:8096636, ECO:0000269|PubMed:8103988}.
Sequence
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRR
LKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Maturity onset diabetes of the young
Transcriptional misregulation in cancer
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Age of onset of childhood onset asthma N/A N/A GWAS
Diabetes Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type 2 diabetes N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 20724036, 23036584, 26173052
Arthritis Rheumatoid Associate 28712091
Atherosclerosis Associate 24371822
Breast Neoplasms Associate 16854221, 19588232, 30457165
Carcinogenesis Associate 20176809, 36008411
Carcinoma Ductal Breast Inhibit 16854221
Carcinoma Non Small Cell Lung Associate 34321041
Carcinoma Squamous Cell Associate 35779918
Chromosomal Instability Associate 37039257
Colorectal Neoplasms Associate 27105501, 36008411, 37039257