Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	30849
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphoinositide-3-kinase regulatory subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIK3R4
Synonyms (NCBI Gene) Gene synonyms aliases	VPS15, p150
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q22.1

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004145	hsa-miR-192-5p	Microarray	16822819
MIRT043838	hsa-miR-330-3p	CLASH	23622248
MIRT041128	hsa-miR-503-5p	CLASH	23622248
MIRT036495	hsa-miR-1226-3p	CLASH	23622248
MIRT726937	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT726936	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT1234903	hsa-miR-1229	CLIP-seq
MIRT1234904	hsa-miR-1279	CLIP-seq
MIRT2296286	hsa-miR-1262	CLIP-seq
MIRT2296287	hsa-miR-1297	CLIP-seq
MIRT2296288	hsa-miR-26a	CLIP-seq
MIRT2296289	hsa-miR-26b	CLIP-seq
MIRT2296290	hsa-miR-4455	CLIP-seq
MIRT2296291	hsa-miR-4465	CLIP-seq
MIRT2296292	hsa-miR-4517	CLIP-seq
MIRT2296293	hsa-miR-4701-3p	CLIP-seq
MIRT2296294	hsa-miR-4704-3p	CLIP-seq
MIRT2296295	hsa-miR-4729	CLIP-seq
MIRT2296296	hsa-miR-4775	CLIP-seq
MIRT2296297	hsa-miR-4802-5p	CLIP-seq
MIRT2296298	hsa-miR-494	CLIP-seq
MIRT2296299	hsa-miR-590-3p	CLIP-seq
MIRT2296300	hsa-miR-609	CLIP-seq
MIRT2296301	hsa-miR-616	CLIP-seq
MIRT2687914	hsa-miR-1251	CLIP-seq
MIRT2687915	hsa-miR-2117	CLIP-seq
MIRT2687916	hsa-miR-3646	CLIP-seq
MIRT2687917	hsa-miR-4273	CLIP-seq
MIRT2687918	hsa-miR-4503	CLIP-seq
MIRT2687919	hsa-miR-4684-5p	CLIP-seq

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000425	Process	Pexophagy	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	8999962
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	14617358, 19270696, 23878393, 24785657, 24849286, 28514442, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IDA	14617358
GO:0005770	Component	Late endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IEA
GO:0005930	Component	Axoneme	ISS
GO:0006468	Process	Protein phosphorylation	NAS	8999962
GO:0006622	Process	Protein targeting to lysosome	NAS	16467569
GO:0006623	Process	Protein targeting to vacuole	IBA
GO:0010506	Process	Regulation of autophagy	IDA	16799551
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IEA
GO:0016241	Process	Regulation of macroautophagy	IDA	10625637
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	20643123
GO:0032801	Process	Receptor catabolic process	IMP	20643123
GO:0034271	Component	Phosphatidylinositol 3-kinase complex, class III, type I	IBA
GO:0034272	Component	Phosphatidylinositol 3-kinase complex, class III, type II	IBA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IEA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IPI	25490155
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	ISS
GO:0036064	Component	Ciliary basal body	IDA
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IDA	8999962
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21062745
GO:0045022	Process	Early endosome to late endosome transport	IDA	14617358
GO:0045171	Component	Intercellular bridge	IDA
GO:0045324	Process	Late endosome to vacuole transport	IBA
GO:0045324	Process	Late endosome to vacuole transport	IEA
GO:0071561	Component	Nucleus-vacuole junction	IBA
GO:0097352	Process	Autophagosome maturation	IDA	10625637
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602610	8982	ENSG00000196455

Protein

UniProt ID

Q99570

Protein name

Phosphoinositide 3-kinase regulatory subunit 4 (PI3-kinase regulatory subunit 4) (EC 2.7.11.1) (PI3-kinase p150 subunit) (Phosphoinositide 3-kinase adaptor protein)

Protein function

Regulatory subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagoso

PDB

7BL1 , 8SOR , 9C82 , 9MHF , 9MHG , 9MHH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	26 → 312	Protein kinase domain	Domain
PF00400	WD40	983 → 1021	WD domain, G-beta repeat	Repeat
PF00400	WD40	1321 → 1358	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8999962}.

Sequence

MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVL
KEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK

Sequence length

1358

Interactions

View interactions

	KEGG		Reactome
	Autophagy - other Autophagy - animal Apelin signaling pathway Alzheimer disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Shigellosis		PI3K Cascade Macroautophagy Synthesis of PIPs at the Golgi membrane Synthesis of PIPs at the early endosome membrane Synthesis of PIPs at the late endosome membrane Toll Like Receptor 9 (TLR9) Cascade RHO GTPases Activate NADPH Oxidases

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Squamous Cell	Stimulate	18618715
Lung Diseases	Associate	39625996
Melanoma	Associate	22912864
Neoplasms	Associate	21563232
Ovarian Neoplasms	Associate	21563232
Spastic paraplegia 11 autosomal recessive	Associate	30081747
Spastic paraplegia 15 autosomal recessive	Associate	30081747
Thyroid Cancer Papillary	Associate	25803323
Uterine Cervical Neoplasms	Associate	18618715

PIK3R4 (phosphoinositide-3-kinase regulatory subunit 4)