Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	30833
Gene name Gene Name - the full gene name approved by the HGNC.	5', 3'-nucleotidase, cytosolic
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NT5C
Synonyms (NCBI Gene) Gene synonyms aliases	DNT, DNT1, HEL74, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5` deoxyribonucleotides (dNTP) and 2`(3`)-dNTP and ribonucleotides, but not 5` ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in it

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044494	hsa-miR-320a	CLASH	23622248
MIRT708324	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT708323	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT708322	hsa-miR-938	HITS-CLIP	19536157
MIRT708321	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT708320	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT708319	hsa-miR-2861	HITS-CLIP	19536157
MIRT708317	hsa-miR-4417	HITS-CLIP	19536157
MIRT708318	hsa-miR-4265	HITS-CLIP	19536157
MIRT708316	hsa-miR-4296	HITS-CLIP	19536157
MIRT708315	hsa-miR-4322	HITS-CLIP	19536157
MIRT708324	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT708323	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT708322	hsa-miR-938	HITS-CLIP	19536157
MIRT708321	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT708320	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT708319	hsa-miR-2861	HITS-CLIP	19536157
MIRT708317	hsa-miR-4417	HITS-CLIP	19536157
MIRT708318	hsa-miR-4265	HITS-CLIP	19536157
MIRT708316	hsa-miR-4296	HITS-CLIP	19536157
MIRT708315	hsa-miR-4322	HITS-CLIP	19536157
MIRT2056805	hsa-miR-1226	CLIP-seq
MIRT2056806	hsa-miR-4640-5p	CLIP-seq
MIRT2056807	hsa-miR-4726-5p	CLIP-seq
MIRT2056808	hsa-miR-634	CLIP-seq
MIRT2056809	hsa-miR-663b	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000255	Process	Allantoin metabolic process	IEA
GO:0005634	Component	Nucleus	IDA	10681516
GO:0005737	Component	Cytoplasm	IDA	10681516
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006204	Process	IMP catabolic process	IEA
GO:0006249	Process	DCMP catabolic process	IEA
GO:0008252	Function	Nucleotidase activity	IDA	10681516
GO:0008252	Function	Nucleotidase activity	IEA
GO:0008253	Function	5'-nucleotidase activity	IBA
GO:0008253	Function	5'-nucleotidase activity	IEA
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009223	Process	Pyrimidine deoxyribonucleotide catabolic process	IBA
GO:0009223	Process	Pyrimidine deoxyribonucleotide catabolic process	IDA	10681516
GO:0009264	Process	Deoxyribonucleotide catabolic process	IEA
GO:0009264	Process	Deoxyribonucleotide catabolic process	IEA
GO:0016311	Process	Dephosphorylation	IDA	10681516
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0019103	Function	Pyrimidine nucleotide binding	IDA	10681516
GO:0042802	Function	Identical protein binding	IPI	31515488, 32296183
GO:0043605	Process	Amide catabolic process	IEA
GO:0046050	Process	UMP catabolic process	IEA
GO:0046055	Process	DGMP catabolic process	IEA
GO:0046074	Process	DTMP catabolic process	IEA
GO:0046079	Process	DUMP catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
191720	17144	ENSG00000125458

Protein

UniProt ID

Q8TCD5

Protein name

5'(3')-deoxyribonucleotidase, cytosolic type (EC 3.1.3.-) (Cytosolic 5',3'-pyrimidine nucleotidase) (Deoxy-5'-nucleotidase 1) (dNT-1)

Protein function

Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.

PDB

2I7D , 4L57 , 4YIH , 6G2N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06941	NT5C	3 → 195		Family

Tissue specificity

TISSUE SPECIFICITY: Detected in skeletal muscle, heart and pancreas. {ECO:0000269|PubMed:10681516}.

Sequence

MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHL
GPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRL
LSWSDNWREILDSKRGAAQRE

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Nicotinate and nicotinamide metabolism Metabolic pathways Nucleotide metabolism		Pyrimidine catabolism Purine catabolism

NT5C (5', 3'-nucleotidase, cytosolic)