KCNIP1 (potassium voltage-gated channel interacting protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30820
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNIP1
Synonyms (NCBI Gene) Gene synonyms aliases
KCHIP1, VABP
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subun
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT1081120 hsa-miR-3168 CLIP-seq
MIRT1081121 hsa-miR-4693-3p CLIP-seq
MIRT1081122 hsa-miR-378g CLIP-seq
MIRT1081123 hsa-miR-4437 CLIP-seq
MIRT1081124 hsa-miR-4674 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005267 Function Potassium channel activity IEA
GO:0005509 Function Calcium ion binding IDA 17187064
GO:0005515 Function Protein binding IPI 15358149, 17057713, 17187064
GO:0005737 Component Cytoplasm IDA 10676964
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604660 15521 ENSG00000182132
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NZI2
Protein name A-type potassium channel modulatory protein KCNIP1 (Kv channel-interacting protein 1) (KChIP1) (Potassium channel-interacting protein 1) (Vesicle APC-binding protein)
Protein function Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels (PubMed:10676964, PubMed:11423117, PubMed:17187064, PubMed:34552243, PubMed:34997220). Regulates channel density, inactivation kinetics and rate
PDB 1S1E , 2I2R , 2NZ0 , 7E83 , 7E84 , 7F3F , 7W6N , 7W6T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 76 → 129 EF-hand domain pair Domain
PF13499 EF-hand_7 135 → 211 EF-hand domain pair Domain
PF13202 EF-hand_5 186 → 210 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.
Sequence 
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Sequence length 227
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Phase 1 - inactivation of fast Na+ channels
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 27846195
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 29176790, 34573389
Body Weight Associate 34573389
Coronary Artery Disease Associate 27864399
Depressive Disorder Associate 34341332
Diabetes Mellitus Type 2 Associate 29491224
Hyperkinesis Associate 29176790
Multiple Sclerosis Associate 31228212
Uterine Cervical Neoplasms Associate 29745858