Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	30820
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium voltage-gated channel interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNIP1
Synonyms (NCBI Gene) Gene synonyms aliases	KCHIP1, VABP
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subun

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT1081120	hsa-miR-3168	CLIP-seq
MIRT1081121	hsa-miR-4693-3p	CLIP-seq
MIRT1081122	hsa-miR-378g	CLIP-seq
MIRT1081123	hsa-miR-4437	CLIP-seq
MIRT1081124	hsa-miR-4674	CLIP-seq
MIRT2020107	hsa-miR-3123	CLIP-seq
MIRT2020108	hsa-miR-4302	CLIP-seq
MIRT2251921	hsa-miR-4436b-3p	CLIP-seq
MIRT2452194	hsa-miR-2467-3p	CLIP-seq
MIRT2452195	hsa-miR-3126-5p	CLIP-seq
MIRT2452196	hsa-miR-3649	CLIP-seq
MIRT2452197	hsa-miR-4503	CLIP-seq
MIRT2452198	hsa-miR-4720-3p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	17187064
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10551270, 14980207, 15358149, 17057713, 17187064, 32296183
GO:0005737	Component	Cytoplasm	IDA	10676964
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006936	Process	Muscle contraction	NAS	21349352
GO:0007268	Process	Chemical synaptic transmission	NAS	21349352
GO:0008016	Process	Regulation of heart contraction	NAS	21349352
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	10676964, 17187064
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	10676964
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	10676964, 17187064
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071196	Component	Kv4.3-KChIP1 channel complex	IPI	17187064
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0086009	Process	Membrane repolarization	NAS	21349352
GO:0097623	Process	Potassium ion export across plasma membrane	NAS	21349352
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	10676964, 17187064

MIM	HGNC	e!Ensembl
604660	15521	ENSG00000182132

Protein

UniProt ID

Q9NZI2

Protein name

A-type potassium channel modulatory protein KCNIP1 (Kv channel-interacting protein 1) (KChIP1) (Potassium channel-interacting protein 1) (Vesicle APC-binding protein)

Protein function

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels (PubMed:10676964, PubMed:11423117, PubMed:17187064, PubMed:34552243, PubMed:34997220). Regulates channel density, inactivation kinetics and rate

PDB

1S1E , 2I2R , 2NZ0 , 7E83 , 7E84 , 7F3F , 7W6N , 7W6T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13833	EF-hand_8	76 → 129	EF-hand domain pair	Domain
PF13499	EF-hand_7	135 → 211	EF-hand domain pair	Domain
PF13202	EF-hand_5	186 → 210	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

Sequence

MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

Sequence length

227

Interactions

View interactions

	Reactome
			Phase 1 - inactivation of fast Na+ channels

KCNIP1 (potassium voltage-gated channel interacting protein 1)