HGF (hepatocyte growth factor)

Gene

• Entrez ID: 3082
• Gene name: Hepatocyte growth factor
• Gene symbol: HGF
• Synonyms (NCBI Gene): DFNB39, F-TCF, HGFB, HPTA, SF
• Chromosome: 7
• Chromosome location: 7q21.11
• Summary: This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853235	C>T	Pathogenic	Synonymous variant, intron variant, coding sequence variant
rs145494248	C>G,T	Benign, conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, coding sequence variant, missense variant
rs145598174	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs148714837	C>T	Benign-likely-benign, likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, genic downstream transcript variant, coding sequence variant
rs367800414	A>G	Conflicting-interpretations-of-pathogenicity	Synonymous variant, genic downstream transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054477	hsa-miR-199a-3p	Luciferase reporter assay, QRTPCR, Western blot	23657814
MIRT054645	hsa-miR-26a-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28393839
MIRT054645	hsa-miR-26a-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28393839
MIRT054645	hsa-miR-26a-5p	ELISA, Luciferase reporter assay, qRT-PCR	28386375
MIRT732936	hsa-miR-144-3p	RNA-seq	33804111
MIRT734648	hsa-miR-28-3p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry, ELISA	34094709
MIRT734649	hsa-miR-193a-5p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry, ELISA	34094709
MIRT1044894	hsa-miR-4446-5p	CLIP-seq
MIRT1044895	hsa-miR-3168	CLIP-seq
MIRT1044896	hsa-miR-4277	CLIP-seq
MIRT1044897	hsa-miR-4424	CLIP-seq
MIRT1044898	hsa-miR-4645-3p	CLIP-seq
MIRT1044899	hsa-miR-4795-3p	CLIP-seq
MIRT1044900	hsa-miR-570	CLIP-seq
MIRT1044901	hsa-miR-582-5p	CLIP-seq
MIRT2451140	hsa-miR-4495	CLIP-seq
MIRT2545797	hsa-miR-1244	CLIP-seq
MIRT2545798	hsa-miR-1305	CLIP-seq
MIRT2545799	hsa-miR-199b-3p	CLIP-seq
MIRT2545800	hsa-miR-3065-5p	CLIP-seq
MIRT2545801	hsa-miR-3129-5p	CLIP-seq
MIRT2545802	hsa-miR-3159	CLIP-seq
MIRT2545803	hsa-miR-3613-5p	CLIP-seq
MIRT2545804	hsa-miR-3692	CLIP-seq
MIRT2545805	hsa-miR-3925-3p	CLIP-seq
MIRT2545806	hsa-miR-421	CLIP-seq
MIRT2545807	hsa-miR-4445	CLIP-seq
MIRT2545808	hsa-miR-4522	CLIP-seq
MIRT2545809	hsa-miR-4703-3p	CLIP-seq
MIRT2545810	hsa-miR-4712-5p	CLIP-seq
MIRT2545811	hsa-miR-495	CLIP-seq
MIRT2545812	hsa-miR-511	CLIP-seq
MIRT1044900	hsa-miR-570	CLIP-seq
MIRT2545813	hsa-miR-580	CLIP-seq
MIRT2545814	hsa-miR-651	CLIP-seq
MIRT2545815	hsa-miR-766	CLIP-seq
MIRT2545816	hsa-miR-770-5p	CLIP-seq
MIRT2545797	hsa-miR-1244	CLIP-seq
MIRT2545798	hsa-miR-1305	CLIP-seq
MIRT2545799	hsa-miR-199b-3p	CLIP-seq
MIRT2545800	hsa-miR-3065-5p	CLIP-seq
MIRT2545801	hsa-miR-3129-5p	CLIP-seq
MIRT2545802	hsa-miR-3159	CLIP-seq
MIRT2545803	hsa-miR-3613-5p	CLIP-seq
MIRT2545804	hsa-miR-3692	CLIP-seq
MIRT2545805	hsa-miR-3925-3p	CLIP-seq
MIRT2545806	hsa-miR-421	CLIP-seq
MIRT2545807	hsa-miR-4445	CLIP-seq
MIRT2545808	hsa-miR-4522	CLIP-seq
MIRT2545809	hsa-miR-4703-3p	CLIP-seq
MIRT2545810	hsa-miR-4712-5p	CLIP-seq
MIRT2545811	hsa-miR-495	CLIP-seq
MIRT2545812	hsa-miR-511	CLIP-seq
MIRT1044900	hsa-miR-570	CLIP-seq
MIRT2545813	hsa-miR-580	CLIP-seq
MIRT2545814	hsa-miR-651	CLIP-seq
MIRT2545815	hsa-miR-766	CLIP-seq
MIRT2545816	hsa-miR-770-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFIC	Unknown	10860846
SP1	Activation	9223667
SP3	Activation	9223667
STAT3	Activation	12168776
STAT3	Unknown	23954444
TFAP2A	Repression	10860846

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	NAS	2531289
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	14679171
GO:0001889	Process	Liver development	IEA
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	2531289
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	1846706, 12694198, 15167892, 16537482, 17804794, 17981115, 18585357, 20624990, 22897854, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	NAS	2531289
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	NAS	2531289
GO:0010507	Process	Negative regulation of autophagy	NAS	24743740
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022603	Process	Regulation of anatomical structure morphogenesis	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	21245381
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IDA	21245381
GO:0042056	Function	Chemoattractant activity	IDA	21245381
GO:0042802	Function	Identical protein binding	IPI	17804794, 20624990, 22897854
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	20655899
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	NAS	22521434
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22521434
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IBA
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IDA	21245381
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20655899
GO:0060326	Process	Cell chemotaxis	IDA	21245381
GO:0060665	Process	Regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IDA	14517989
GO:0060665	Process	Regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IDA	20655899
GO:1900744	Process	Regulation of p38MAPK cascade	IEA
GO:1901299	Process	Negative regulation of hydrogen peroxide-mediated programmed cell death	IDA	20655899
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	2531289

Other IDs

• MIM: 142409
• HGNC: 4893
• e!Ensembl: ENSG00000019991

Protein

• UniProt ID: P14210
• Protein name: Hepatocyte growth factor (Hepatopoietin-A) (Scatter factor) (SF) [Cleaved into: Hepatocyte growth factor alpha chain; Hepatocyte growth factor beta chain]
• Protein function: Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types (PubMed:20624990). Activating ligand for the receptor tyrosine kinase MET by b
• PDB: 1BHT, 1GMN, 1GMO, 1GP9, 1NK1, 1SHY, 1SI5, 2HGF, 2QJ2, 3HMS, 3HMT, 3HN4, 3MKP, 3SP8, 4D3C, 4K3J, 4O3T, 4O3U, 5COE, 5CP9, 5CS1, 5CS3, 5CS5, 5CS9, 5CSQ, 5CT1, 5CT2, 5CT3, 7MO7, 7MO8, 7MO9, 7MOA, 7MOB, 7OCL, 7OCM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00024	PAN_1	40 → 124	PAN domain	Domain
  PF00051	Kringle	128 → 206	Kringle domain	Domain
  PF00051	Kringle	211 → 288	Kringle domain	Domain
  PF00051	Kringle	305 → 383	Kringle domain	Domain
  PF00051	Kringle	391 → 469	Kringle domain	Domain
  PF00089	Trypsin	495 → 716	Trypsin	Domain

• Sequence:

  MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
  TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
  NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
  RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
  HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
  ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
  ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
  DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
  DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
  LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
  NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
  AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
  LTYKVPQS

• Sequence length: 728

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Malaria
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - reactive oxygen species
Renal cell carcinoma
Melanoma
Non-small cell lung cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Platelet degranulation
PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
MET Receptor Activation
Negative regulation of MET activity
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
MET activates RAS signaling
MET activates PI3K/AKT signaling
MET activates PTPN11
MET activates PTK2 signaling
MET interacts with TNS proteins
MET activates RAP1 and RAC1
MET receptor recycling
MET activates STAT3

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Autosomal recessive nonsyndromic hearing loss 39	Pathogenic	rs137853235, rs1788701297, rs900334407	RCV000016089 RCV000016090 RCV000016091
Sensorineural hearing loss disorder	Pathogenic	rs1788701297	RCV005420504

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Hearing impairment	Uncertain significance	rs747516423	RCV001375429
Hepatocellular carcinoma	Benign	rs2074725	RCV005923494
HGF-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	rs745851853, rs150267054, rs745648975, rs750744461	RCV003976151 RCV003950280 RCV003921371 RCV003959365
Lung cancer	Uncertain significance	rs374484762	RCV005888331
Nonsyndromic Hearing Loss, Mixed	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs142045938, rs766769838, rs774508303, rs886062457, rs565056780, rs538415452, rs199638850, rs886062456, rs371103859, rs771889279, rs150267054, rs375901177, rs28719812, rs182057547, rs886062458, rs758149409, rs5745609, rs5745768, rs1800793, rs5745635, rs5745687	RCV000362654 RCV000355882 RCV000368393 RCV000270369 RCV000391658 RCV000298690 RCV000321516 RCV000343182 RCV000311558 RCV000333616 RCV000283216 RCV000378490 RCV000286375 RCV000285931 RCV000384633 RCV000334350 RCV000399680 RCV000374709 RCV000391680 RCV000327792 RCV000276154
Ovarian serous cystadenocarcinoma	Likely benign	rs199848928	RCV005916028

Associations from Text Mining
Disease Name	Relationship Type	References
Acquired ichthyosis	Associate	36303457
Acro Osteolysis	Associate	35145077
Acute Disease	Associate	38045696
Acute Kidney Injury	Inhibit	16501492
Acute Kidney Injury	Associate	21618526, 26327776
Acute Lung Injury	Stimulate	18065658
Acute Lung Injury	Associate	26674641
Adenocarcinoma	Associate	7573364
Adenocarcinoma of Lung	Associate	11290563, 17459054, 20150826, 26919104, 35635202
Adenocarcinoma of Lung	Stimulate	19817696
Airway Obstruction	Associate	17392321
Alzheimer Disease	Associate	26417591, 34440700
Anodontia	Associate	32792856
Ascites	Associate	31039761, 33921783
Astrocytoma	Stimulate	12115353
Atrial Fibrillation	Associate	30697920
Atrial Fibrillation	Stimulate	36801832
Atrial Remodeling	Associate	30697920
Autism Spectrum Disorder	Associate	19360663
Autoimmune Diseases	Associate	36175465
Behcet Syndrome	Associate	22683544
Bile Duct Diseases	Associate	7573364
Blast Injuries	Associate	31621494
Bone Diseases	Associate	16497877, 23431957, 28334277, 29337876, 35145077
Brain Ischemia	Inhibit	18853759
Brain Neoplasms	Associate	20200025
Breast Neoplasms	Associate	11571297, 17699109, 18160707, 18499206, 18564920, 19188684, 21489997, 22850551, 23049908, 25029565, 25492484, 26781475, 26934743, 27097643, 27175600, 30004628, 30314527, 30518672, 32188473, 34344422, 35034243, 35085554, 35650297, 8160769
Breast Neoplasms	Inhibit	18941460
Breast Neoplasms Male	Associate	32188473
Bronchiolitis Obliterans Syndrome	Stimulate	19344464
Bronchiolitis Viral	Associate	30562046
Bronchopulmonary Dysplasia	Associate	31967847
Calcinosis Cutis	Associate	21959198
Capillary Leak Syndrome	Inhibit	25539852
Carcinogenesis	Associate	14555767, 16189274, 21489997, 22251819, 25633809, 26099202, 34381422, 7573364, 9876767
Carcinoid Tumor	Stimulate	23339006
Carcinoma	Associate	25844809
Carcinoma Basal Cell	Associate	36788083
Carcinoma Hepatocellular	Associate	11533045, 11854908, 12883474, 15632311, 16014626, 19293637, 19447220, 20080086, 20977675, 21658389, 22418436, 22859706, 22912725, 22962849, 24532842, 24590895, 25148256, 25574092, 25591763, 25620570, 26000702, 26099202, 26695141, 26790028, 27077227, 27579536, 28245423, 28358369, 28456666, 30663411, 30761258, 33155201, 33760164, 34093861, 35650297, 37014321, 38184822, 9094433
Carcinoma Hepatocellular	Inhibit	1657643
Carcinoma Hepatocellular	Stimulate	23977005
Carcinoma Intraductal Noninfiltrating	Associate	24025166
Carcinoma Non Small Cell Lung	Associate	15083185, 21779788, 22980976, 24722154, 25323938, 27374174, 29986736, 30569179, 32792859, 33335011, 9649128
Carcinoma Non Small Cell Lung	Stimulate	28121629, 8980383
Carcinoma Pancreatic Ductal	Associate	21105966, 28064436, 7573364
Carcinoma Papillary	Associate	9781430
Carcinoma Renal Cell	Associate	10454537, 15151998, 16983094, 24609899, 24914205, 25564569, 31994979, 35546143, 37170275, 9781430
Carcinoma Squamous Cell	Associate	14970860, 33717076
Carcinoma Squamous Cell	Inhibit	1657643
Cardiovascular Diseases	Associate	18274928, 19223201
Cartilage Diseases	Associate	10558853
CD59 Deficiency	Associate	36627004
Cell Transformation Neoplastic	Associate	11238734
Chemical and Drug Induced Liver Injury	Associate	26327776
Cholecystitis	Associate	40221697
Cholesteatoma	Associate	33627146
Chondrosarcoma	Associate	23320110
Chordoma	Associate	27072875, 34127734
Chronic Limb Threatening Ischemia	Associate	24947080, 32875492, 40221835
Clear cell metastatic renal cell carcinoma	Associate	34965953
Cognition Disorders	Associate	36737481
Colitis Ulcerative	Associate	17260007, 27809916
Colonic Neoplasms	Associate	12519076
Colorectal Neoplasms	Associate	11073815, 11557528, 11725828, 12918110, 15991286, 17260007, 21098338, 23277013, 23532910, 24425103, 25083765, 25244939, 25306394, 27793046, 27799652, 28209746, 28573382, 30897285, 32800944, 36010567, 36303457, 36591565, 38212428
Common Cold	Inhibit	28538696
Corneal Injuries	Associate	32016117
Coronary Artery Disease	Associate	11087242, 39675594
Coronary Disease	Associate	38310303
COVID 19	Associate	34032853, 34489933, 37388734
Critical Illness	Stimulate	32360286
Cysts	Stimulate	22683544
Deafness	Associate	33976695
Death	Inhibit	22617129
Death	Associate	35927556, 9777945
Dental Plaque	Associate	20122857
Depressive Disorder	Associate	22832727
Depressive Disorder Major	Associate	39501335
Dermatitis Atopic	Associate	28821884
Dermatofibrosarcoma	Associate	34362454
Diabetes Gestational	Associate	28112754
Diabetes Mellitus	Stimulate	19577077
Diabetes Mellitus	Associate	32875492
Diabetes Mellitus Type 1	Associate	27406064, 36303457
Diabetes Mellitus Type 2	Associate	26290879, 33760164, 39926598
Diabetic Foot	Inhibit	36232122
Diabetic Nephropathies	Associate	31895808, 33858824, 36726458
Diabetic Retinopathy	Stimulate	16186340
Disease	Associate	30665391, 38081679
Drug Related Side Effects and Adverse Reactions	Inhibit	11571297
Drug Related Side Effects and Adverse Reactions	Associate	25323938
Dysplastic Nevus Syndrome	Associate	9781430
Edema	Associate	36087188
End Stage Liver Disease	Associate	21520010, 24532842
Endometrial Neoplasms	Associate	12524084, 12631221, 22617129, 31992589
Endometriosis	Stimulate	12524084, 15831511
Endometriosis	Associate	15602080, 25852006, 34930225
Enterocolitis Necrotizing	Associate	31383782
Eosinophilic Granuloma	Inhibit	20819464
Epiretinal Membrane	Associate	15156160
Epiretinal Membrane	Stimulate	30665391
Esophageal Neoplasms	Associate	25885021
Esophageal Squamous Cell Carcinoma	Associate	20534479, 26036285, 27706656, 31533461, 34037097
Essential Hypertension	Associate	15127882
External Auditory Canal Bilateral Atresia Of With Congenital Vertical Talus	Associate	15875782
Fatigue	Associate	25047123
Femur Head Necrosis	Associate	29510550
Fetal Growth Retardation	Inhibit	9777945
Fibromatosis Gingival	Associate	10507724
Fibromyalgia	Associate	37670381
Fibrosis	Associate	19223201, 25284705, 37240308, 40237197
Fibrosis	Inhibit	25697336, 30697920
Fibrosis	Stimulate	38015590
Focal Nodular Hyperplasia	Associate	9781430
Gallbladder Neoplasms	Associate	8698619
Gastrointestinal Neoplasms	Associate	15846300
Gastrointestinal Stromal Tumors	Stimulate	25844809
Gastrointestinal Stromal Tumors	Associate	30221743
Gingival Recession	Associate	30664222
Glaucoma Angle Closure	Associate	21897747, 23585864, 30348125
Glioblastoma	Associate	11238734, 11296484, 11909963, 22203985, 26637806, 26654598, 29238047, 30886866, 34667077, 7556648
Glioblastoma	Stimulate	12115353, 24518591
Glioma	Associate	11238734, 11296484, 12115353, 15584904, 18077431, 18992144, 20157762, 20646316, 22741575, 26654598, 7556648, 9263534
Glycogen Storage Disease Type IV	Stimulate	15005271
Glycosuria Renal	Associate	19858036
Gout	Associate	36627004
Hashimoto Disease	Associate	20558345
Hearing Loss	Associate	14512973, 30303587
Hearing Loss Sensorineural	Stimulate	14512973
Heart Diseases	Associate	18853759
Heart Failure	Associate	39675594
Hemangiosarcoma	Associate	25844809
Hematologic Neoplasms	Inhibit	24256874
Hepatitis C	Associate	34344422
Hepatoblastoma	Associate	21992464
Hereditary Autoinflammatory Diseases	Associate	36175465
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415, 30394935
Histiocytoma Benign Fibrous	Associate	11564169
Hodgkin Disease	Associate	11159538, 24141626
Hyperglycemia	Associate	19858036
Hyperopia	Associate	21897747
Hyperpigmentation	Associate	11564169
Hypertension	Associate	15127882, 25047123
Hypertension	Stimulate	39595551
Hypertrophy	Associate	23811540
Hypoxia	Stimulate	12726861, 18234850, 18422749, 24914205, 27612459
Hypoxia	Associate	22383739
Hypoxia Brain	Associate	25068796, 27612459
Idiopathic Pulmonary Fibrosis	Stimulate	25697336
Idiopathic Pulmonary Fibrosis	Associate	34948231
Infections	Associate	29510550
Infertility	Associate	36303457
Inflammation	Inhibit	18201972, 23484149, 25539852
Inflammation	Associate	18396786, 19405838, 21048961, 25690371, 27809916, 30739483, 31621494, 36138045, 36627004, 37388734
Inflammatory Bowel Diseases	Associate	39501335
Insulin Resistance	Associate	26420861, 33760164
Intraabdominal Infections	Associate	31480453
Ischemia	Associate	32875492
Ischemia	Inhibit	36232122
Keratoconus	Associate	22003120, 24416191, 25735481, 36051483
Kidney Cortex Necrosis	Associate	38287102
Kidney Diseases	Associate	18201972, 30143691, 38081679
Kidney Failure Chronic	Inhibit	15882257
Laryngeal Diseases	Associate	35513993
Leiomyoma	Associate	36771423
Leiomyosarcoma	Stimulate	25844809
Leukemia	Associate	21486864, 24561793, 30425048
Leukemia Lymphocytic Chronic B Cell	Associate	21486864, 24561793, 8554973
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22904675
Leukemia Myeloid Acute	Associate	23919981, 30425048, 34514432, 34789086, 36534523, 38022627, 39300580
Leukemia Myelomonocytic Chronic	Stimulate	30026572
Leukemia Promyelocytic Acute	Associate	19471602
Leukemia T Cell	Associate	8554973
Leukocytosis	Associate	22965887
Liver Cirrhosis	Associate	35650297
Liver Diseases	Associate	36195310
Liver Failure	Associate	26327776, 9546344
Liver Failure Acute	Associate	26327776, 3276728, 7681834
Lung Diseases	Associate	28855398
Lung Diseases Interstitial	Associate	21520010, 25697336
Lung Neoplasms	Associate	19817696, 21959198, 22052230, 24099107, 30569179, 31096000, 34185790, 35650297, 8980383
Lung Neoplasms	Stimulate	31104010
Lymphangiectasis Intestinal	Associate	18564920
Lymphatic Metastasis	Associate	21779788, 29134462, 31533461, 33655604
Lymphedema	Associate	18564920, 22351697
Lymphoma	Associate	9028331
Lymphoma Large B Cell Diffuse	Associate	15491290
Lymphoma Large Cell Anaplastic	Associate	30206415
Lymphoma Non Hodgkin	Associate	35677036
Lymphoma Primary Effusion	Associate	28407694
Lymphoma T Cell	Associate	19120365
Malignant mesenchymal tumor	Associate	8863670
Medulloblastoma	Associate	18059365, 18992144, 19244381, 26496080, 32818841
Melanoma	Associate	16455654, 16645588, 17597814, 20164843, 21654344, 22763439, 26302068, 27689874, 36303457, 9546344
Melanoma	Inhibit	1657643
Meniere Disease	Stimulate	36175465
Meningioma	Associate	12115353
Mesothelioma	Associate	11027427, 17872495, 22065079, 35319795
Mesothelioma Malignant	Associate	12612292, 17872495, 22246193, 9569039
Metabolic Syndrome	Associate	19223316
Microsatellite Instability	Associate	23277013
Migraine Disorders	Stimulate	37938611
Mitochondrial Diseases	Inhibit	11571297
Monoclonal Gammopathy of Undetermined Significance	Associate	23431957
Mucopolysaccharidosis III	Associate	34329663
Multiple Myeloma	Associate	11830493, 16189274, 16497877, 17593251, 17823079, 18509644, 18512025, 19187270, 19228610, 20658475, 21131364, 23232072, 23431957, 24450886, 26220195, 30353654, 8916966
Multiple Myeloma	Stimulate	24326130
Multiple Sclerosis	Associate	32457139
Myasthenia Gravis	Associate	37414259
Myelodysplastic Syndromes	Associate	24106013, 24410667
Myocardial Infarction	Associate	10598900
Myocardial Ischemia	Associate	23484149
Myopia	Associate	19471602, 22509107, 24766640, 30665391
Myostatin related muscle hypertrophy	Associate	28869034
Nasal Polyps	Associate	20819464
Nasopharyngeal Carcinoma	Associate	24722284
Nasopharyngeal Neoplasms	Associate	18789327
Neoplasm Invasiveness	Associate	11259105, 17699109
Neoplasm Metastasis	Associate	10037743, 10433927, 11027427, 11259105, 11290563, 11854908, 12464636, 15684480, 15846300, 15972969, 16455654, 16858414, 19244381, 19533745, 20215403, 20583256, 21734448, 21779788, 22251819, 22912725, 25169209, 26695141, 27296289, 27706656, 28334277, 29099290, 29134462, 29781036, 30569179, 30897285, 35085554, 36109787, 9028331, 9624561
Neoplasm Metastasis	Stimulate	22533346, 23320110, 23532910, 31161784, 36591565, 37828456
Neoplasms	Associate	10037743, 10468286, 10713114, 11027427, 11290563, 11296484, 11759110, 11854908, 11909963, 12183053, 12519076, 12631221, 12726861, 12819026, 1386559, 14555767, 14970860, 15083185, 15684480, 15846300, 15972969, 16244541, 1657643, 16869958, 16983094, 17071599, 17409099, 17699109, 17948912, 18053801, 18422749, 18499206, 18709663, 18728788, 18941460, 19139131, 19188684, 19502802, 19533745, 19826195, 19939254, 19959938, 20150826, 20215403, 20406887, 21105966, 21131364, 21159665, 21489997, 21734448, 21779788, 22052230, 22198430, 22369755, 22389872, 22617129, 22619305, 22689056, 22741575, 22763439, 22859706, 22869872, 23232072, 23320110, 23339006, 23532910, 23598276, 24025166, 24450886, 24722284, 24827412, 24914205, 24952592, 25068796, 25244939, 25272043, 25306394, 25552591, 25807104, 25844809, 25885021, 26000702, 26099202, 26496080, 26637806, 26934743, 27127175, 27175600, 27296289, 27374174, 27689874, 28012218, 28393839, 28545495, 28829508, 28978320, 30108175, 30469509, 30569179, 30850583, 30897285, 31136962, 31533461, 31994979, 32065021, 32134113, 32188473, 32193747, 32717381, 32792856, 33655604, 34029144, 34344422, 34381422, 34624218, 34789086, 35034243, 35085554, 35227290, 35319795, 35449152, 36012373, 36303457, 36416133, 36647832, 37828456, 38169917, 39302921, 7681834, 8440743, 8698619, 9000597, 9028331, 9546344, 9624561, 9781430, 9817840
Neoplasms	Stimulate	11073815, 16810744, 29433373, 31161784, 8980383
Neoplasms	Inhibit	11533045, 15632311, 16014626, 19567783, 29133945, 30024813
Neurilemmoma	Associate	20200025
Neuroblastoma	Stimulate	19661350
Neuroblastoma	Associate	19939254, 31137515, 34556815
Neurodegenerative Diseases	Associate	36614096
Neurofibrosarcoma	Associate	17558420, 20739432
Neurofibrosarcoma	Stimulate	25844809
Neuroinflammatory Diseases	Inhibit	23166786
Neuroma Acoustic	Associate	25692621
Neutrophil Immunodeficiency Syndrome	Associate	36627004
Nevus Pigmented	Associate	16455654
Noonan like syndrome	Associate	24025166
Obesity	Associate	18274928
Obesity	Stimulate	25690371
Oncogene Addiction	Inhibit	29133945
Optic Nerve Glioma	Associate	18234969
Osteoarthritis	Associate	11212179
Osteosarcoma	Associate	11167845, 33797312
Ovarian Neoplasms	Associate	15839837, 19959938, 20583256, 21724856, 23467907, 23513043, 24952592, 28075407, 29099290, 29920310, 31097475
Pancreatic Neoplasms	Associate	11259105, 18422749, 18625714, 23672538, 26381405, 28205613, 31161784, 35449152, 9665481
Pancreatitis Chronic	Inhibit	30680957
Parkinson Disease	Associate	25276829
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	18396786
Periodontitis	Associate	34128105
Peripheral Arterial Disease	Inhibit	15005271
Peripheral Arterial Disease	Associate	30104096
Peripheral Arterial Disease	Stimulate	32202143
Peritoneal Diseases	Stimulate	12524084
Peritonitis	Associate	33655604
Personality Disorders	Associate	16244541
Pituitary Neoplasms	Associate	20200025
Placenta Diseases	Associate	9777945
Pneumonia	Inhibit	25539852
Polycythemia Vera	Associate	22965887
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	8554973
Prostate cancer familial	Associate	29095436
Prostatic Neoplasms	Associate	16869958, 20200161, 20406887, 25272043, 27787597, 28440432, 30186533, 32143478, 35204839, 35650297, 37460872, 9624561
Prostatic Neoplasms	Stimulate	20835261
Prostatitis	Associate	15972969, 20200161, 20215403, 20406887, 22689056, 37240308
Proteinuria	Associate	25047123
Pulmonary Arterial Hypertension	Stimulate	21258008
Pulmonary Disease Chronic Obstructive	Associate	16216128, 29472603, 34335580
Pulmonary Disease Chronic Obstructive	Stimulate	25125975
Pulmonary Disease Chronic Obstructive	Inhibit	33656381
Pulmonary Embolism	Stimulate	30594174
Pulmonary Fibrosis	Associate	12177240
Radiation Injuries	Associate	31136962
Respiratory Distress Syndrome	Stimulate	18065658
Respiratory Distress Syndrome	Associate	34163488
Retinal Detachment	Stimulate	32542038
Retinal Diseases	Associate	15156160
Retinal Neovascularization	Associate	15156160
Retinal Perforations	Stimulate	33430811
Retinal Vein Occlusion	Associate	25978399
Retinoblastoma	Associate	11533045
Retinopathy of Prematurity	Stimulate	10751359
Rheumatic Diseases	Associate	33313931
Rheumatic Heart Disease	Associate	30697920
Salivary Gland Diseases	Associate	31136962
Sarcoma Alveolar Soft Part	Associate	32127467
Sarcoma Clear Cell	Stimulate	25844809
Sarcopenia	Associate	36821647
Schizophrenia	Associate	31959813
Scleroderma Systemic	Associate	21520010
Seminoma	Associate	30646583
Shock Septic	Associate	33863396
Silicosis	Associate	26400297
Skin Diseases	Associate	25707609
Skin Neoplasms	Inhibit	11821397
Skull Base Neoplasms	Associate	17948912
Small Cell Lung Carcinoma	Stimulate	28121629
Small Cell Lung Carcinoma	Associate	37828456
Smith McCort Dysplasia	Associate	20020816
Spinal Cord Injuries	Stimulate	24968203
Squamous Cell Carcinoma of Head and Neck	Associate	18283272, 18836279, 19385965, 21899661, 22869872, 24722284, 26319934, 28475003, 31940827, 32064753, 34599215, 35275524
Stomach Neoplasms	Associate	12674216, 1386559, 16244541, 19497102, 19533745, 21734448, 22238368, 24887009, 25592281, 27683052, 28012218, 29134462, 29781036, 32788873, 35650297, 8440743, 8612619, 9119743, 9459603
Tarlov Cysts	Stimulate	31161784, 35449152
Thrombosis	Associate	30594174
Thyroid Cancer Papillary	Associate	17409099, 29426928
Thyroid Neoplasms	Associate	12733712, 17409099
Thyroid Nodule	Associate	20558345
Thyroiditis	Associate	12733712
Trigeminal Neuralgia	Inhibit	34067581
Triple Negative Breast Neoplasms	Associate	22788954
Urinary Bladder Neoplasms	Associate	9781430
Uterine Cervical Neoplasms	Associate	16977794
Uveal melanoma	Associate	19032678, 24551032, 28138035, 9546344
Vascular Calcification	Associate	21920521
Vascular Diseases	Associate	27612459
Vitreoretinopathy Proliferative	Stimulate	15156160
Vitreoretinopathy Proliferative	Associate	15988409, 27936052
Vocal Cord Paralysis	Associate	35513993
Weight Loss	Associate	24141897
Werner Syndrome	Associate	32320127