Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	307
Gene name Gene Name - the full gene name approved by the HGNC.	Annexin A4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANXA4
Synonyms (NCBI Gene) Gene synonyms aliases	ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocyto

Show/Hide all(185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	27418678
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT576961	hsa-miR-8061	HITS-CLIP	27418678
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786508	hsa-miR-1305	CLIP-seq
MIRT786509	hsa-miR-1324	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786511	hsa-miR-3148	CLIP-seq
MIRT786512	hsa-miR-3149	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786514	hsa-miR-3171	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786517	hsa-miR-3609	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT786521	hsa-miR-369-3p	CLIP-seq
MIRT786522	hsa-miR-374c	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT786524	hsa-miR-421	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT786528	hsa-miR-4668-5p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT786532	hsa-miR-548ah	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786534	hsa-miR-548t	CLIP-seq
MIRT786535	hsa-miR-568	CLIP-seq
MIRT786536	hsa-miR-584	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786540	hsa-miR-655	CLIP-seq
MIRT1931970	hsa-miR-1	CLIP-seq
MIRT1931971	hsa-miR-1287	CLIP-seq
MIRT1931972	hsa-miR-206	CLIP-seq
MIRT1931973	hsa-miR-208a	CLIP-seq
MIRT1931974	hsa-miR-208b	CLIP-seq
MIRT1931975	hsa-miR-320e	CLIP-seq
MIRT1931976	hsa-miR-3617	CLIP-seq
MIRT1931977	hsa-miR-3673	CLIP-seq
MIRT1931978	hsa-miR-3688-3p	CLIP-seq
MIRT786521	hsa-miR-369-3p	CLIP-seq
MIRT1931979	hsa-miR-374a	CLIP-seq
MIRT1931980	hsa-miR-374b	CLIP-seq
MIRT1931981	hsa-miR-4291	CLIP-seq
MIRT1931982	hsa-miR-4307	CLIP-seq
MIRT1931983	hsa-miR-4310	CLIP-seq
MIRT1931984	hsa-miR-4517	CLIP-seq
MIRT1931985	hsa-miR-4729	CLIP-seq
MIRT1931986	hsa-miR-499-5p	CLIP-seq
MIRT1931987	hsa-miR-613	CLIP-seq
MIRT1931988	hsa-miR-641	CLIP-seq
MIRT2172417	hsa-miR-124	CLIP-seq
MIRT2172418	hsa-miR-128	CLIP-seq
MIRT2172419	hsa-miR-132	CLIP-seq
MIRT2172420	hsa-miR-148a	CLIP-seq
MIRT2172421	hsa-miR-148b	CLIP-seq
MIRT2172422	hsa-miR-152	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT2172423	hsa-miR-212	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT1931985	hsa-miR-4729	CLIP-seq
MIRT2172424	hsa-miR-4773	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT2172425	hsa-miR-488	CLIP-seq
MIRT2172426	hsa-miR-506	CLIP-seq
MIRT2172427	hsa-miR-548an	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT2475350	hsa-miR-3662	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT2475351	hsa-miR-3973	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT2475352	hsa-miR-4251	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT2475353	hsa-miR-4274	CLIP-seq
MIRT2475354	hsa-miR-4280	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT2475355	hsa-miR-4329	CLIP-seq
MIRT2475356	hsa-miR-4519	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT2475357	hsa-miR-4670-3p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT2475358	hsa-miR-520g	CLIP-seq
MIRT2475359	hsa-miR-520h	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786511	hsa-miR-3148	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786517	hsa-miR-3609	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT2475350	hsa-miR-3662	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT2475351	hsa-miR-3973	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT2475352	hsa-miR-4251	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT2475353	hsa-miR-4274	CLIP-seq
MIRT2475354	hsa-miR-4280	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT2475355	hsa-miR-4329	CLIP-seq
MIRT2675074	hsa-miR-4421	CLIP-seq
MIRT2475356	hsa-miR-4519	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT786528	hsa-miR-4668-5p	CLIP-seq
MIRT2475357	hsa-miR-4670-3p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT2475358	hsa-miR-520g	CLIP-seq
MIRT2475359	hsa-miR-520h	CLIP-seq
MIRT786532	hsa-miR-548ah	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786534	hsa-miR-548t	CLIP-seq
MIRT2675075	hsa-miR-580	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004859	Function	Phospholipase inhibitor activity	NAS	2970257
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	IDA	20237821
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016
GO:0005544	Function	Calcium-dependent phospholipid binding	NAS	2970257
GO:0005634	Component	Nucleus	IDA	16687573, 20237821
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	20237821
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005886	Component	Plasma membrane	IDA	16687573
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	20237821
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0007219	Process	Notch signaling pathway	IEA
GO:0009986	Component	Cell surface	IDA	22056994
GO:0012506	Component	Vesicle membrane	IDA	16687573
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031965	Component	Nuclear membrane	IDA	16687573
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	20237821
GO:0032717	Process	Negative regulation of interleukin-8 production	IMP	22056994
GO:0042802	Function	Identical protein binding	IPI	16687573
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301, 20237821
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16687573
GO:0051059	Function	NF-kappaB binding	IPI	20237821
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 28675934
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145

MIM	HGNC	e!Ensembl
106491	542	ENSG00000196975

Protein

UniProt ID

P09525

Protein name

Annexin A4 (35-beta calcimedin) (Annexin IV) (Annexin-4) (Carbohydrate-binding protein p33/p41) (Chromobindin-4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4-X) (Placental anticoagulant protein II) (PAP-II) (Protein II)

Protein function

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

PDB

2ZOC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	18 → 83	Annexin	Family
PF00191	Annexin	90 → 155	Annexin	Family
PF00191	Annexin	173 → 239	Annexin	Family
PF00191	Annexin	249 → 314	Annexin	Family

Sequence

MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTI
GRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEE
IRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYE
AGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIV
KCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
GDTSGDYRKVLLVLCGGDD

Sequence length

319

Interactions

View interactions

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	28416818
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	16316942
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	17330099
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	15108329
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	15108329

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma		15108329	ClinVar
Atrial Fibrillation	Atrial Fibrillation			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA
Dental caries	Dental caries			GWAS
Myocardial Infarction	Myocardial Infarction			GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Clear Cell	Associate	21348943, 24244679
Adenocarcinoma Clear Cell	Stimulate	24244679
Adenoma Pleomorphic	Associate	24205396
Alzheimer Disease	Associate	37925455
Arthritis Rheumatoid	Associate	15642131
Atrial Fibrillation	Inhibit	37581400
Carcinogenesis	Associate	22970268
Carcinoma Adenosquamous	Associate	27402115
Carcinoma Hepatocellular	Stimulate	26779633
Carcinoma Renal Cell	Stimulate	22321069, 37464398
Carcinoma Renal Cell	Associate	33828127
Carcinoma Squamous Cell	Associate	27485544
Cholangiocarcinoma	Associate	28943450
Cholangitis Sclerosing	Associate	28943450
Colorectal Neoplasms	Associate	16893879, 21209152, 22799385, 25206290, 26495974, 28986585, 33761465
Dysferlinopathy	Associate	39350328
Endometrial Neoplasms	Associate	22415234
Gallbladder Neoplasms	Stimulate	24833881
Glaucoma	Associate	35862065
Glomerulonephritis Membranous	Associate	35862065
Growth Disorders	Associate	24244679
Helicobacter Infections	Stimulate	22970268
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22759382
Hydrocephalus Normal Pressure	Associate	37277809
Infections	Associate	3143800
Kidney Neoplasms	Stimulate	33828127
Lung Neoplasms	Associate	33846781
Neoplasm Metastasis	Associate	26495974
Neoplasm Metastasis	Stimulate	26779633
Neoplasms	Associate	16893879, 22321069, 22759382, 24205396, 24244679, 24833881, 33125094, 33761465
Neoplasms	Stimulate	22970268, 27402115
Ovarian Neoplasms	Associate	21348943, 22321069, 24244679, 31474227, 33125094
Pathological Conditions Anatomical	Associate	35862065
Pre Eclampsia	Associate	26028931
Retinal Vein Occlusion	Stimulate	26779633
Sjogren's Syndrome	Associate	31366407
Stomach Neoplasms	Stimulate	22970268
Stomach Neoplasms	Associate	30837034
Uterine Cervical Neoplasms	Associate	27402115

ANXA4 (annexin A4)