Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3066
Gene name	Histone deacetylase 2
Gene symbol	HDAC2
Synonyms (NCBI Gene)	HD2KDAC2RPD3YAF1
Chromosome	6
Chromosome location	6q21
Summary	This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3

526

Show/Hide all (526)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007307	hsa-miR-145-5p	Luciferase reporter assay	23499894
MIRT023724	hsa-miR-1-3p	Proteomics	18668040
MIRT045549	hsa-miR-149-5p	CLASH	23622248
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT733684	hsa-miR-494-3p	Flow cytometryLuciferase reporter assayMicroarrayqRT-PCRWestern blotting	31465536
MIRT736874	hsa-miR-204-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	33614251
MIRT1042307	hsa-let-7a	CLIP-seq
MIRT1042308	hsa-let-7b	CLIP-seq
MIRT1042309	hsa-let-7c	CLIP-seq
MIRT1042310	hsa-let-7d	CLIP-seq
MIRT1042311	hsa-let-7e	CLIP-seq
MIRT1042312	hsa-let-7f	CLIP-seq
MIRT1042313	hsa-let-7g	CLIP-seq
MIRT1042314	hsa-let-7i	CLIP-seq
MIRT1042315	hsa-miR-103a	CLIP-seq
MIRT1042316	hsa-miR-107	CLIP-seq
MIRT1042317	hsa-miR-1205	CLIP-seq
MIRT1042318	hsa-miR-1226	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042320	hsa-miR-1254	CLIP-seq
MIRT1042321	hsa-miR-1262	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042325	hsa-miR-1295	CLIP-seq
MIRT1042326	hsa-miR-1304	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT1042329	hsa-miR-186	CLIP-seq
MIRT1042330	hsa-miR-188-3p	CLIP-seq
MIRT1042331	hsa-miR-197	CLIP-seq
MIRT1042332	hsa-miR-202	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042334	hsa-miR-2467-3p	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042336	hsa-miR-3116	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042338	hsa-miR-3124-3p	CLIP-seq
MIRT1042339	hsa-miR-3133	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042342	hsa-miR-3153	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042344	hsa-miR-3173-3p	CLIP-seq
MIRT1042345	hsa-miR-3177-5p	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042349	hsa-miR-338-5p	CLIP-seq
MIRT1042350	hsa-miR-3605-5p	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT1042353	hsa-miR-362-5p	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT1042355	hsa-miR-3656	CLIP-seq
MIRT1042356	hsa-miR-3668	CLIP-seq
MIRT1042357	hsa-miR-3671	CLIP-seq
MIRT1042358	hsa-miR-3682-5p	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042361	hsa-miR-3690	CLIP-seq
MIRT1042362	hsa-miR-3691-3p	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT1042367	hsa-miR-3915	CLIP-seq
MIRT1042368	hsa-miR-3924	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT1042370	hsa-miR-3928	CLIP-seq
MIRT1042371	hsa-miR-3937	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT1042373	hsa-miR-4269	CLIP-seq
MIRT1042374	hsa-miR-4275	CLIP-seq
MIRT1042375	hsa-miR-4282	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042377	hsa-miR-4328	CLIP-seq
MIRT1042378	hsa-miR-4428	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042380	hsa-miR-4458	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042382	hsa-miR-4476	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042386	hsa-miR-4500	CLIP-seq
MIRT1042387	hsa-miR-4511	CLIP-seq
MIRT1042388	hsa-miR-451b	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042390	hsa-miR-4638-3p	CLIP-seq
MIRT1042391	hsa-miR-4646-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT1042393	hsa-miR-4668-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042395	hsa-miR-4699-3p	CLIP-seq
MIRT1042396	hsa-miR-4701-3p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042400	hsa-miR-4744	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042402	hsa-miR-4755-3p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042408	hsa-miR-495	CLIP-seq
MIRT1042409	hsa-miR-500b	CLIP-seq
MIRT1042410	hsa-miR-501-5p	CLIP-seq
MIRT1042411	hsa-miR-502-5p	CLIP-seq
MIRT1042412	hsa-miR-511	CLIP-seq
MIRT1042413	hsa-miR-520d-5p	CLIP-seq
MIRT1042414	hsa-miR-524-5p	CLIP-seq
MIRT1042415	hsa-miR-526b	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT1042417	hsa-miR-548b-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT1042421	hsa-miR-548k	CLIP-seq
MIRT1042422	hsa-miR-548n	CLIP-seq
MIRT1042423	hsa-miR-548p	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT1042425	hsa-miR-556-3p	CLIP-seq
MIRT1042426	hsa-miR-558	CLIP-seq
MIRT1042427	hsa-miR-579	CLIP-seq
MIRT1042428	hsa-miR-587	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042430	hsa-miR-607	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT1042432	hsa-miR-633	CLIP-seq
MIRT1042433	hsa-miR-661	CLIP-seq
MIRT1042434	hsa-miR-98	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042307	hsa-let-7a	CLIP-seq
MIRT1042308	hsa-let-7b	CLIP-seq
MIRT1042309	hsa-let-7c	CLIP-seq
MIRT1042310	hsa-let-7d	CLIP-seq
MIRT1042311	hsa-let-7e	CLIP-seq
MIRT1042312	hsa-let-7f	CLIP-seq
MIRT1042313	hsa-let-7g	CLIP-seq
MIRT1042314	hsa-let-7i	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042320	hsa-miR-1254	CLIP-seq
MIRT1042321	hsa-miR-1262	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042326	hsa-miR-1304	CLIP-seq
MIRT2008921	hsa-miR-135a	CLIP-seq
MIRT2008922	hsa-miR-135b	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT1042332	hsa-miR-202	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2008925	hsa-miR-2114	CLIP-seq
MIRT2008926	hsa-miR-223	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042336	hsa-miR-3116	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042344	hsa-miR-3173-3p	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT2008927	hsa-miR-3194-3p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2008928	hsa-miR-325	CLIP-seq
MIRT2008929	hsa-miR-3607-3p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2008930	hsa-miR-3663-5p	CLIP-seq
MIRT2008931	hsa-miR-3686	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042361	hsa-miR-3690	CLIP-seq
MIRT2008932	hsa-miR-374c	CLIP-seq
MIRT2008933	hsa-miR-377	CLIP-seq
MIRT2008934	hsa-miR-3923	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042377	hsa-miR-4328	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT1042378	hsa-miR-4428	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042380	hsa-miR-4458	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042386	hsa-miR-4500	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042390	hsa-miR-4638-3p	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2008939	hsa-miR-4659a-3p	CLIP-seq
MIRT2008940	hsa-miR-4659b-3p	CLIP-seq
MIRT2008941	hsa-miR-4666-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042396	hsa-miR-4701-3p	CLIP-seq
MIRT2008942	hsa-miR-4704-5p	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2008944	hsa-miR-4778-3p	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042412	hsa-miR-511	CLIP-seq
MIRT1042415	hsa-miR-526b	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2008947	hsa-miR-578	CLIP-seq
MIRT1042427	hsa-miR-579	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2008948	hsa-miR-616	CLIP-seq
MIRT2008949	hsa-miR-655	CLIP-seq
MIRT2008950	hsa-miR-890	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042434	hsa-miR-98	CLIP-seq
MIRT2241267	hsa-miR-1206	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT2241268	hsa-miR-1321	CLIP-seq
MIRT2241269	hsa-miR-15a	CLIP-seq
MIRT2241270	hsa-miR-15b	CLIP-seq
MIRT2241271	hsa-miR-16	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT1042329	hsa-miR-186	CLIP-seq
MIRT2241272	hsa-miR-195	CLIP-seq
MIRT1042331	hsa-miR-197	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2008925	hsa-miR-2114	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042339	hsa-miR-3133	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2241273	hsa-miR-323-5p	CLIP-seq
MIRT2241274	hsa-miR-342-3p	CLIP-seq
MIRT2241275	hsa-miR-3529	CLIP-seq
MIRT1042350	hsa-miR-3605-5p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241276	hsa-miR-3622b-5p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT2241279	hsa-miR-3664-3p	CLIP-seq
MIRT2241280	hsa-miR-3672	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT2241281	hsa-miR-379	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT2241282	hsa-miR-3934	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT2241284	hsa-miR-424	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2241285	hsa-miR-4270	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2241287	hsa-miR-4441	CLIP-seq
MIRT2241288	hsa-miR-4451	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2241289	hsa-miR-4477a	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT2241290	hsa-miR-4488	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042387	hsa-miR-4511	CLIP-seq
MIRT2241291	hsa-miR-4524	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2241292	hsa-miR-4537	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2241293	hsa-miR-4649-5p	CLIP-seq
MIRT2241294	hsa-miR-4650-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT2241296	hsa-miR-4695-5p	CLIP-seq
MIRT2241297	hsa-miR-4697-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT2241298	hsa-miR-4718	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT2241299	hsa-miR-4739	CLIP-seq
MIRT1042400	hsa-miR-4744	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT2241300	hsa-miR-4756-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT2241301	hsa-miR-4766-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT2241302	hsa-miR-486-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT2241303	hsa-miR-497	CLIP-seq
MIRT2241304	hsa-miR-500a	CLIP-seq
MIRT2241305	hsa-miR-503	CLIP-seq
MIRT2241306	hsa-miR-510	CLIP-seq
MIRT2241307	hsa-miR-512-5p	CLIP-seq
MIRT1042413	hsa-miR-520d-5p	CLIP-seq
MIRT1042414	hsa-miR-524-5p	CLIP-seq
MIRT2241308	hsa-miR-541	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241310	hsa-miR-646	CLIP-seq
MIRT2241311	hsa-miR-654-5p	CLIP-seq
MIRT2241312	hsa-miR-758	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq
MIRT2241314	hsa-miR-876-3p	CLIP-seq
MIRT2008950	hsa-miR-890	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2388925	hsa-miR-4651	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2388926	hsa-miR-608	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT1042433	hsa-miR-661	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT2451037	hsa-miR-192	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2451038	hsa-miR-215	CLIP-seq
MIRT2451039	hsa-miR-28-3p	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2451040	hsa-miR-3591-3p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT2451041	hsa-miR-4305	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT2451042	hsa-miR-4731-3p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2451043	hsa-miR-4801	CLIP-seq
MIRT1042417	hsa-miR-548b-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT2451039	hsa-miR-28-3p	CLIP-seq
MIRT2465436	hsa-miR-3659	CLIP-seq
MIRT2465437	hsa-miR-3921	CLIP-seq
MIRT2465438	hsa-miR-4653-5p	CLIP-seq
MIRT2465439	hsa-miR-4658	CLIP-seq
MIRT2465440	hsa-miR-4682	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT2465441	hsa-miR-574-5p	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT2545012	hsa-miR-3163	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT2241279	hsa-miR-3664-3p	CLIP-seq
MIRT2241280	hsa-miR-3672	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2545013	hsa-miR-4434	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT2545014	hsa-miR-4516	CLIP-seq
MIRT2545015	hsa-miR-4531	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2545016	hsa-miR-4662a-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT2241296	hsa-miR-4695-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2545017	hsa-miR-4786-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT2241306	hsa-miR-510	CLIP-seq
MIRT2241307	hsa-miR-512-5p	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT2545018	hsa-miR-548ad	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2545019	hsa-miR-566	CLIP-seq
MIRT2545020	hsa-miR-570	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT2545012	hsa-miR-3163	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT2241282	hsa-miR-3934	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2545013	hsa-miR-4434	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT2545014	hsa-miR-4516	CLIP-seq
MIRT2545015	hsa-miR-4531	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2545016	hsa-miR-4662a-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2545017	hsa-miR-4786-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT2545018	hsa-miR-548ad	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
MYC	Activation	20697349
MYCN	Activation	20697349
RFX5	Unknown	16464847
YY1	Unknown	11532945

114

Show/Hide all (114)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	9651585
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19041327, 19276356
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000785	Component	Chromatin	HDA	16217013
GO:0000785	Component	Chromatin	IEA
GO:0001221	Function	Transcription coregulator binding	IPI	19041327
GO:0001975	Process	Response to amphetamine	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IDA	16642021, 28497810
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	ISS
GO:0005515	Function	Protein binding	IPI	9150135, 11062478, 11259576, 11641274, 11739383, 12140263, 12176973, 12670868, 12711603, 14752048, 16254079, 16464847, 16919237, 17245431, 17314511, 17318229, 17827154, 17956988, 17984088, 18451879, 19182791, 19343227, 19433865, 19497860, 19505873, 19703393, 19729656, 19805145, 2019
GO:0005634	Component	Nucleus	IDA	18347167, 20523938, 24970816, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24970816
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	12711221
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006338	Process	Chromatin remodeling	IC	17827154
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18347167
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009913	Process	Epidermal cell differentiation	ISS	21093383
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IMP	19276356
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS	18754010
GO:0016358	Process	Dendrite development	ISS
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	17827154, 19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0019213	Function	Deacetylase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	11062478, 11641274
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0031000	Process	Response to caffeine	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0031507	Process	Heterochromatin formation	IBA
GO:0031507	Process	Heterochromatin formation	IEA
GO:0031507	Process	Heterochromatin formation	IMP	19372552
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0032991	Component	Protein-containing complex	IDA	28046085
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IMP	18316616
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	19041327
GO:0033558	Function	Protein lysine deacetylase activity	TAS
GO:0034605	Process	Cellular response to heat	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035098	Component	ESC/E(Z) complex	IDA	20075857
GO:0036211	Process	Protein modification process	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042393	Function	Histone binding	IDA	19276356
GO:0042475	Process	Odontogenesis of dentin-containing tooth	ISS	21093383
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042733	Process	Embryonic digit morphogenesis	ISS	21093383
GO:0042826	Function	Histone deacetylase binding	IPI	28046085
GO:0043066	Process	Negative regulation of apoptotic process	ISS	21093383
GO:0045862	Process	Positive regulation of proteolysis	IMP	19041327
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19041327, 19372552
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IMP	18316616
GO:0051059	Function	NF-kappaB binding	IEA
GO:0051059	Function	NF-kappaB binding	IPI	17785205
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060789	Process	Hair follicle placode formation	ISS	21093383
GO:0061000	Process	Negative regulation of dendritic spine development	IEA
GO:0061029	Process	Eyelid development in camera-type eye	ISS	21093383
GO:0061198	Process	Fungiform papilla formation	ISS	21093383
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	17827154, 22926524
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070822	Component	Sin3-type complex	IDA	14966270, 17827154
GO:0070822	Component	Sin3-type complex	IEA
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:0160008	Function	Protein decrotonylase activity	IEA
GO:0160009	Function	Histone decrotonylase activity	IDA	28497810
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IDA	29192674
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IEA
GO:0160216	Function	Protein lysine delactylase activity	IDA	35044827
GO:0160216	Function	Protein lysine delactylase activity	IEA
GO:1902437	Process	Positive regulation of male mating behavior	IEA
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1903351	Process	Cellular response to dopamine	IEA
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

MIM	HGNC	e!Ensembl
605164	4853	ENSG00000196591

Q92769

Protein name

Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-)

Protein function

Histone deacetylase that catalyzes the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed:28497810). Histone deacetylation gives a tag for epigenetic repression and plays an important role

PDB

3MAX , 4LXZ , 4LY1 , 5IWG , 5IX0 , 6G3O , 6WBW , 6WBZ , 6WHN , 6WHO , 6WHQ , 6WHZ , 6WI3 , 6XDM , 6XEB , 6XEC , 7JS8 , 7KBG , 7KBH , 7LTG , 7LTK , 7LTL , 7MOS , 7MOT , 7MOX , 7MOY , 7MOZ , 7ZZO , 7ZZP , 7ZZR , 7ZZS , 7ZZT , 7ZZU , 7ZZW , 8A0B , 8BPA , 8BPB , 8BPC , 8C60 , 9DTQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00850	Hist_deacetyl	29 → 320	Histone deacetylase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed; lower levels in brain and lung.

Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP

Sequence length

488

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Polycomb repressive complex Cell cycle Longevity regulating pathway - multiple species Notch signaling pathway TGF-beta signaling pathway Neutrophil extracellular trap formation Thyroid hormone signaling pathway Huntington disease Amphetamine addiction Alcoholism Human papillomavirus infection Epstein-Barr virus infection Pathways in cancer Transcriptional misregulation in cancer Viral carcinogenesis MicroRNAs in cancer Chronic myeloid leukemia		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants HDACs deacetylate histones Notch-HLH transcription pathway SUMOylation of chromatin organization proteins Regulation of TP53 Activity through Acetylation RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription Regulation of MECP2 expression and activity EGR2 and SOX10-mediated initiation of Schwann cell myelination Factors involved in megakaryocyte development and platelet production

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial pancreatic carcinoma	Benign	rs200805519	RCV005902935
HDAC2-related disorder	Likely benign; Uncertain significance	rs1252367140, rs367736850, rs2482611700, rs1312623763	RCV003929580 RCV003929532 RCV003949411 RCV003949176
Lung cancer	Benign	rs200805519	RCV005902938
Ovarian cancer	Benign	rs200805519	RCV005902934
Ovarian serous cystadenocarcinoma	Benign	rs200805519	RCV005902936
Uterine carcinosarcoma	Benign	rs200805519	RCV005902937
Uterine corpus endometrial carcinoma	Benign	rs200805519	RCV005902939

Show/Hide Text Mining Associations (149)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondrogenesis type 2	Associate	27884646
Adenocarcinoma	Associate	19057998
Adenocarcinoma of Lung	Associate	25333250, 27356570
AIDS Associated Nephropathy	Associate	21315782
Alcoholism	Associate	21447001
Alzheimer Disease	Associate	25219501
Amyotrophic Lateral Sclerosis	Associate	27982123, 37328865
Anemia Diamond Blackfan	Associate	34036344
Asthma	Associate	20538962, 24030221, 33510050, 37312162
Asthma	Inhibit	31391381
Astrocytoma	Associate	21143702
Ataxia Telangiectasia	Associate	37345209
Atrial Fibrillation	Associate	40033384
Autism Spectrum Disorder	Associate	35877665
Autoimmune Diseases	Associate	30463877
Bipolar Disorder	Associate	27959513
Bipolar Disorder	Inhibit	39600279
Brain Neoplasms	Associate	37598220
Breast Neoplasms	Associate	12176973, 12527756, 19383825, 23627572, 24376786, 24488910, 25139823, 32110804, 32686908, 33617509, 37749212
Bronchiolitis Obliterans Syndrome	Associate	30303525
Carcinogenesis	Associate	25473896, 28203711, 35260183
Carcinoma Hepatocellular	Associate	21206745, 24616922, 26352599, 28434945, 31636472, 34319031, 35764883
Carcinoma Hepatocellular	Stimulate	27342975
Carcinoma Non Small Cell Lung	Associate	22965008, 23110995, 28839465, 31713888, 35611803, 37291119
Carcinoma Ovarian Epithelial	Associate	18714364
Carcinoma Pancreatic Ductal	Associate	20398369, 28028031
Carcinoma Papillary	Stimulate	23873102
Carcinoma Squamous Cell	Associate	27356570
Cardiomegaly	Associate	25388210
Cardiomyopathy Dilated	Associate	19332114
Cardiovascular Diseases	Associate	25013374
Chordoma	Associate	23893747
Colonic Neoplasms	Associate	19057998, 36246978
Colorectal Neoplasms	Associate	19057998, 19881542, 21290163, 23708667, 24948597, 28538837, 33267897
COVID 19	Associate	35305722, 36305426, 36840831
Cryptogenic Organizing Pneumonia	Associate	31545224
Death	Stimulate	26352599
Dementia	Associate	37328865
Depressive Disorder	Associate	27959513
Depressive Disorder Major	Stimulate	27959513
Developmental Disabilities	Associate	35468861
Diabetes Mellitus	Stimulate	30217947
Diabetes Mellitus	Associate	34233433
Diabetes Mellitus Type 2	Associate	37066707
Diabetic Foot	Associate	33096729
Emphysema	Inhibit	37373058
Endometriosis	Associate	22344732
Epilepsy Familial Mesial Temporal Lobe	Stimulate	33258018
Esophageal Squamous Cell Carcinoma	Associate	30363984
Friedreich Ataxia	Associate	24933366
Gallbladder Neoplasms	Associate	23242568
Genetic Diseases Inborn	Associate	30463877
Glioblastoma	Associate	30654849, 32328646, 35260183, 35417530
Glioma	Associate	18708058, 21143702, 32328646, 37528157
Glioma	Stimulate	30654849
Glucocorticoid Receptor Deficiency	Associate	16380507, 21828034, 24368768, 26617781, 34091451, 39526770
Gout	Associate	30728075
Graves Disease	Associate	23193417
Hamartoma Syndrome Multiple	Inhibit	23717666
Hearing Loss Sensorineural	Associate	34091451, 39526770
Hematologic Diseases	Stimulate	36293392
Hepatoblastoma	Associate	27635950
Heredodegenerative Disorders Nervous System	Associate	35877665
HIV Infections	Associate	21200019
Hodgkin Disease	Associate	29481474
HTLV I Infections	Associate	25136952
Huntington Disease	Associate	24933366
Hyperglycemia	Associate	34639171
Hypoxia	Associate	35840042, 37543278
Idiopathic Pulmonary Fibrosis	Associate	31545224
Inflammation	Associate	24030221, 25013374, 26498345, 26617781, 29142617, 37312162
Inflammation	Inhibit	26809128
Keloid	Associate	31545402
Kidney Neoplasms	Associate	35974388
Latent Autoimmune Diabetes in Adults	Associate	26839444
Leiomyoma	Associate	31761932
Leiomyosarcoma	Associate	36497061
Leukemia Lymphocytic Chronic B Cell	Associate	25944469
Leukemia Myeloid Acute	Associate	22096027, 25473896, 26858310, 28030834, 28203711, 31254352
Leukemia T Cell	Associate	21535412
Lung Diseases Interstitial	Associate	31545224
Lung Injury	Associate	33413422
Lung Neoplasms	Associate	23110995, 25605253, 25970771, 27356570, 30868056, 34203519
Lung Neoplasms	Stimulate	24441677
Lymphatic Metastasis	Stimulate	23242568
Lymphatic Metastasis	Associate	32865179
Lymphoma	Associate	25076845
Lymphoma Large B Cell Diffuse	Associate	25605023
Lymphoma T Cell Cutaneous	Associate	18671804, 28288848
Malignant mesenchymal tumor	Associate	22037263
Medulloblastoma	Stimulate	25853389
Medulloblastoma	Associate	32822486
Melanoma	Associate	35055045
Melioidosis	Associate	28628607
Mesothelioma	Associate	25970771, 26254420
Mesothelioma Malignant	Associate	26254420
Midline granulomatosis	Associate	31989434
Mouth Neoplasms	Stimulate	32865179
Multiple Myeloma	Associate	25482492
Muscle Weakness	Associate	28526090
Nasopharyngeal Carcinoma	Associate	26934447, 37082996
Neoplasm Metastasis	Associate	23242568
Neoplasm Metastasis	Stimulate	23627572
Neoplasm Metastasis	Inhibit	33267897
Neoplasms	Stimulate	16309230, 26352599, 29333444
Neoplasms	Associate	16638127, 18212746, 19057998, 19860841, 21143702, 22037263, 22158273, 22699815, 23242568, 23627572, 24265759, 25139823, 25473896, 25486475, 26209800 View all (18 more)
Neoplasms	Inhibit	19372580, 33267897
Neoplasms Basal Cell	Associate	25921176
Neoplasms Squamous Cell	Associate	22029821
Neuraminidase 1 deficiency	Associate	25115389
Neuroblastoma	Associate	23706636, 36130928, 37488358, 38063204
Neurocognitive Disorders	Associate	21315782
Neurodegenerative Diseases	Associate	33802405
Neuroendocrine Tumors	Associate	37543278
Neurotoxicity Syndromes	Associate	33802405
Obesity	Associate	29142617
Obsessive Compulsive Disorder	Associate	34730715
Osteoarthritis	Associate	27884646, 30063117
Osteosarcoma	Associate	28984297, 30868056, 31337976
Pancreatic Neoplasms	Associate	20398369, 26502922
Pancreatic Neoplasms	Stimulate	25275504
Penile Induration	Associate	23770939
Progeria	Associate	30109767
Prostatic Neoplasms	Associate	18212746, 22531786, 30453545, 30720161, 34034634, 37543278
Pulmonary Disease Chronic Obstructive	Associate	15888697, 16380507, 18421014, 24368768, 26498345, 33510050, 37373058
Pulmonary Disease Chronic Obstructive	Inhibit	23717666, 26809128, 28526090, 37180749
Rhabdoid Tumor	Stimulate	23764045
Rhinitis Allergic	Associate	35480562
Sarcoma	Associate	22037263, 26254420
Schizophrenia	Associate	27959513
Schizophrenia	Inhibit	30530989
Sepsis	Associate	28628607
Skin Diseases	Associate	22344732
Sleep Apnea Obstructive	Associate	26636516
Smoke Inhalation Injury	Inhibit	24030221
Squamous Cell Carcinoma of Head and Neck	Associate	27349552
Squamous Cell Carcinoma of Head and Neck	Stimulate	32865179
Status Asthmaticus	Inhibit	33626953
Stomach Neoplasms	Stimulate	24668547, 34232196
Thyroid Diseases	Associate	23873102
Thyroid Neoplasms	Associate	30669676
Trigger Finger Disorder	Associate	34233433
Urethral Neoplasms	Associate	27250763, 35624179
Urinary Bladder Neoplasms	Associate	25921176, 26729194
Uterine Cervical Dysplasia	Associate	22029821
Uterine Cervical Neoplasms	Associate	24606473, 24965412
Uveal melanoma	Associate	35332245
Varicose Veins	Associate	36293392
Vascular Diseases	Associate	30217947

HDAC2 (histone deacetylase 2)