ANXA3 (annexin A3)

Gene

• Entrez ID: 306
• Gene name: Annexin A3
• Gene symbol: ANXA3
• Synonyms (NCBI Gene): ANX3
• Chromosome: 4
• Chromosome location: 4q21.21
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of pho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030154	hsa-miR-26b-5p	Microarray	19088304
MIRT786503	hsa-miR-1305	CLIP-seq
MIRT786504	hsa-miR-374c	CLIP-seq
MIRT786505	hsa-miR-655	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0004859	Function	Phospholipase inhibitor activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016, 2138632
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17205602
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7526843
GO:0006909	Process	Phagocytosis	IDA	9497492
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	16236264
GO:0012506	Component	Vesicle membrane	IBA
GO:0016020	Component	Membrane	IDA	17205602
GO:0019834	Function	Phospholipase A2 inhibitor activity	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IDA	7526843
GO:0042581	Component	Specific granule	IDA	7526843
GO:0042742	Process	Defense response to bacterium	IDA	9497492
GO:0043312	Process	Neutrophil degranulation	IDA	9550422
GO:0045766	Process	Positive regulation of angiogenesis	IDA	16236264
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	16236264
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 106490
• HGNC: 541
• e!Ensembl: ENSG00000138772

Protein

• UniProt ID: P12429
• Protein name: Annexin A3 (35-alpha calcimedin) (Annexin III) (Annexin-3) (Inositol 1,2-cyclic phosphate 2-phosphohydrolase) (Lipocortin III) (Placental anticoagulant protein III) (PAP-III)
• Protein function: Inhibitor of phospholipase A2, also possesses anti-coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.
• PDB: 1AII, 1AXN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	22 → 87	Annexin	Family
  PF00191	Annexin	94 → 159	Annexin	Family
  PF00191	Annexin	177 → 243	Annexin	Family
  PF00191	Annexin	253 → 318	Annexin	Family

• Sequence:

  MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
  QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
  TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
  ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
  LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
  SAIKSDTSGDYEITLLKICGGDD

• Sequence length: 323