Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3059
Gene name Gene Name - the full gene name approved by the HGNC.	Hematopoietic cell-specific Lyn substrate 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HCLS1
Synonyms (NCBI Gene) Gene synonyms aliases	CTTNL, HS1, lckBP1, p75
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.33

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041795	hsa-miR-484	CLASH	23622248
MIRT1042051	hsa-miR-103a	CLIP-seq
MIRT1042052	hsa-miR-107	CLIP-seq
MIRT1042053	hsa-miR-128	CLIP-seq
MIRT1042054	hsa-miR-1301	CLIP-seq
MIRT1042055	hsa-miR-1321	CLIP-seq
MIRT1042056	hsa-miR-1827	CLIP-seq
MIRT1042057	hsa-miR-214	CLIP-seq
MIRT1042058	hsa-miR-27a	CLIP-seq
MIRT1042059	hsa-miR-27b	CLIP-seq
MIRT1042060	hsa-miR-3153	CLIP-seq
MIRT1042061	hsa-miR-3162-5p	CLIP-seq
MIRT1042062	hsa-miR-3612	CLIP-seq
MIRT1042063	hsa-miR-3619-5p	CLIP-seq
MIRT1042064	hsa-miR-4443	CLIP-seq
MIRT1042065	hsa-miR-4520a-3p	CLIP-seq
MIRT1042066	hsa-miR-4520b-3p	CLIP-seq
MIRT1042067	hsa-miR-4529-3p	CLIP-seq
MIRT1042068	hsa-miR-4533	CLIP-seq
MIRT1042069	hsa-miR-4668-5p	CLIP-seq
MIRT1042070	hsa-miR-4731-3p	CLIP-seq
MIRT1042071	hsa-miR-4739	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT1042073	hsa-miR-4756-5p	CLIP-seq
MIRT1042074	hsa-miR-4801	CLIP-seq
MIRT1042075	hsa-miR-5047	CLIP-seq
MIRT1042076	hsa-miR-650	CLIP-seq
MIRT1042077	hsa-miR-761	CLIP-seq
MIRT1042078	hsa-miR-873	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT1042056	hsa-miR-1827	CLIP-seq
MIRT2241213	hsa-miR-4305	CLIP-seq
MIRT2241214	hsa-miR-4470	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT2544806	hsa-miR-2355-5p	CLIP-seq
MIRT2544807	hsa-miR-3649	CLIP-seq
MIRT2544808	hsa-miR-3667-3p	CLIP-seq
MIRT2544809	hsa-miR-593	CLIP-seq
MIRT2544810	hsa-miR-626	CLIP-seq

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001085	Function	RNA polymerase II transcription factor binding	IPI	23001182
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 21398607, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	23001182
GO:0005634	Component	Nucleus	ISS
GO:0005667	Component	Transcription regulator complex	IDA	23001182
GO:0005737	Component	Cytoplasm	IDA	23001182
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005884	Component	Actin filament	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of transcription, DNA-templated	TAS	2587259
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009725	Process	Response to hormone	ISS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IMP	23001182
GO:0017124	Function	SH3 domain binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	23001182
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030427	Component	Site of polarized growth	IBA	21873635
GO:0030833	Process	Regulation of actin filament polymerization	IBA	21873635
GO:0030833	Process	Regulation of actin filament polymerization	IMP	23001182
GO:0030854	Process	Positive regulation of granulocyte differentiation	IMP	23001182
GO:0030864	Component	Cortical actin cytoskeleton	IBA	21873635
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	23001182
GO:0035556	Process	Intracellular signal transduction	TAS	8978766
GO:0042307	Process	Positive regulation of protein import into nucleus	IMP	23001182
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23001182
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	23001182
GO:0051015	Function	Actin filament binding	IBA	21873635
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	23001182
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	23001182
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	23001182
GO:2000107	Process	Negative regulation of leukocyte apoptotic process	IMP	23001182
GO:2000251	Process	Positive regulation of actin cytoskeleton reorganization	IC	23001182

MIM	HGNC	e!Ensembl
601306	4844	ENSG00000180353

Protein

UniProt ID

P14317

Protein name

Hematopoietic lineage cell-specific protein (Hematopoietic cell-specific LYN substrate 1) (LckBP1) (p75)

Protein function

Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02218	HS1_rep	82 → 117	Repeat in HS1/Cortactin	Repeat
PF02218	HS1_rep	119 → 154	Repeat in HS1/Cortactin	Repeat
PF02218	HS1_rep	156 → 191	Repeat in HS1/Cortactin	Repeat
PF02218	HS1_rep	193 → 220	Repeat in HS1/Cortactin	Repeat
PF00018	SH3_1	434 → 479	SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in tissues and cells of hematopoietic origin.

Sequence

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKA
KFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVY
EAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA
GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPAN
YVKLLE

Sequence length

486

Interactions

View interactions

	KEGG
	Tight junction Bacterial invasion of epithelial cells Pathogenic Escherichia coli infection Shigellosis Proteoglycans in cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	12833524

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Behcet Syndrome	Associate	37264476
Carcinoma	Associate	24051699
Colorectal Neoplasms	Associate	32293320
Leukemia	Associate	22768161
Leukemia Lymphocytic Chronic B Cell	Associate	15931393, 22768161, 24532043, 25350848, 32732361
Lupus Erythematosus Systemic	Associate	15022330
Neoplasms	Associate	26903547, 35568781
Periodontitis	Associate	27302879
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	33773540
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	33773540
Waldenstrom Macroglobulinemia	Associate	26903547

HCLS1 (hematopoietic cell-specific Lyn substrate 1)