HCLS1 (hematopoietic cell-specific Lyn substrate 1)

Gene

• Entrez ID: 3059
• Gene name: Hematopoietic cell-specific Lyn substrate 1
• Gene symbol: HCLS1
• Synonyms (NCBI Gene): CTTNL, HS1, lckBP1, p75
• Chromosome: 3
• Chromosome location: 3q13.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041795	hsa-miR-484	CLASH	23622248
MIRT1042051	hsa-miR-103a	CLIP-seq
MIRT1042052	hsa-miR-107	CLIP-seq
MIRT1042053	hsa-miR-128	CLIP-seq
MIRT1042054	hsa-miR-1301	CLIP-seq
MIRT1042055	hsa-miR-1321	CLIP-seq
MIRT1042056	hsa-miR-1827	CLIP-seq
MIRT1042057	hsa-miR-214	CLIP-seq
MIRT1042058	hsa-miR-27a	CLIP-seq
MIRT1042059	hsa-miR-27b	CLIP-seq
MIRT1042060	hsa-miR-3153	CLIP-seq
MIRT1042061	hsa-miR-3162-5p	CLIP-seq
MIRT1042062	hsa-miR-3612	CLIP-seq
MIRT1042063	hsa-miR-3619-5p	CLIP-seq
MIRT1042064	hsa-miR-4443	CLIP-seq
MIRT1042065	hsa-miR-4520a-3p	CLIP-seq
MIRT1042066	hsa-miR-4520b-3p	CLIP-seq
MIRT1042067	hsa-miR-4529-3p	CLIP-seq
MIRT1042068	hsa-miR-4533	CLIP-seq
MIRT1042069	hsa-miR-4668-5p	CLIP-seq
MIRT1042070	hsa-miR-4731-3p	CLIP-seq
MIRT1042071	hsa-miR-4739	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT1042073	hsa-miR-4756-5p	CLIP-seq
MIRT1042074	hsa-miR-4801	CLIP-seq
MIRT1042075	hsa-miR-5047	CLIP-seq
MIRT1042076	hsa-miR-650	CLIP-seq
MIRT1042077	hsa-miR-761	CLIP-seq
MIRT1042078	hsa-miR-873	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT1042056	hsa-miR-1827	CLIP-seq
MIRT2241213	hsa-miR-4305	CLIP-seq
MIRT2241214	hsa-miR-4470	CLIP-seq
MIRT1042072	hsa-miR-4747-5p	CLIP-seq
MIRT2544806	hsa-miR-2355-5p	CLIP-seq
MIRT2544807	hsa-miR-3649	CLIP-seq
MIRT2544808	hsa-miR-3667-3p	CLIP-seq
MIRT2544809	hsa-miR-593	CLIP-seq
MIRT2544810	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 21398607, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	23001182
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005667	Component	Transcription regulator complex	IDA	23001182
GO:0005737	Component	Cytoplasm	IDA	23001182
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	2587259
GO:0007015	Process	Actin filament organization	IDA	23001182
GO:0007165	Process	Signal transduction	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009725	Process	Response to hormone	IEA
GO:0009725	Process	Response to hormone	ISS
GO:0016020	Component	Membrane	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	23001182
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030833	Process	Regulation of actin filament polymerization	IMP	23001182
GO:0030854	Process	Positive regulation of granulocyte differentiation	IEA
GO:0030854	Process	Positive regulation of granulocyte differentiation	IMP	23001182
GO:0035556	Process	Intracellular signal transduction	TAS	8978766
GO:0035591	Function	Signaling adaptor activity	IMP	23001182
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	IMP	23001182
GO:0042307	Process	Positive regulation of protein import into nucleus	IMP	23001182
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23001182
GO:0051015	Function	Actin filament binding	TAS	23001182
GO:0051169	Process	Nuclear transport	IMP	23001182
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	23001182
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	23001182
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	23001182
GO:2000107	Process	Negative regulation of leukocyte apoptotic process	IMP	23001182

Other IDs

• MIM: 601306
• HGNC: 4844
• e!Ensembl: ENSG00000180353

Protein

• UniProt ID: P14317
• Protein name: Hematopoietic lineage cell-specific protein (Hematopoietic cell-specific LYN substrate 1) (LckBP1) (p75)
• Protein function: Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02218	HS1_rep	82 → 117	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	119 → 154	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	156 → 191	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	193 → 220	Repeat in HS1/Cortactin	Repeat
  PF00018	SH3_1	434 → 479	SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed only in tissues and cells of hematopoietic origin.
• Sequence:

  MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
  VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
  GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGE
  TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKA
  KFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
  EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVY
  EAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA
  GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPAN
  YVKLLE

• Sequence length: 486

Pathways

KEGG:

Tight junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Proteoglycans in cancer