Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3055
Gene name Gene Name - the full gene name approved by the HGNC.	HCK proto-oncogene, Src family tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HCK
Synonyms (NCBI Gene) Gene synonyms aliases	AIPCV, JTK9, p59Hck, p61Hck
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respirator

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1600755957	G>T	Likely-pathogenic	Stop gained, coding sequence variant

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments
MIRT1042041	hsa-miR-1245b-3p	CLIP-seq
MIRT1042042	hsa-miR-3654	CLIP-seq
MIRT1042043	hsa-miR-3915	CLIP-seq
MIRT1042044	hsa-miR-3928	CLIP-seq
MIRT1042045	hsa-miR-4318	CLIP-seq
MIRT1042046	hsa-miR-4496	CLIP-seq
MIRT1042047	hsa-miR-4520a-3p	CLIP-seq
MIRT1042048	hsa-miR-4638-3p	CLIP-seq
MIRT1042049	hsa-miR-4738-3p	CLIP-seq
MIRT1042050	hsa-miR-548g	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
PML	Unknown	21993313
RARA	Unknown	21993313
SPI1	Unknown	21993313

Show/Hide all(82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0002376	Process	Immune system process	IEA
GO:0002522	Process	Leukocyte migration involved in immune response	TAS	18538446
GO:0002758	Process	Innate immune response-activating signaling pathway	IEA
GO:0002758	Process	Innate immune response-activating signaling pathway	TAS	18538446
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	10861086, 16921024
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	10092522
GO:0004713	Function	Protein tyrosine kinase activity	TAS	3496523
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	7859737, 10092522, 11278465, 11741929, 12029088, 14993658, 15784897, 16273093, 16374509, 16636290, 17141806, 18042718, 19234535, 20670214, 22641034, 22939624, 23397142, 24658140, 24728074, 24860872, 25036101, 25416956, 25469238, 25814554, 25825872, 31980649, 32226298, 32296183, 3270
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	15998323
GO:0005764	Component	Lysosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	15998323
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005901	Component	Caveola	IDA	7791757
GO:0005901	Component	Caveola	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	IMP	11904303
GO:0006468	Process	Protein phosphorylation	TAS	3496523
GO:0006887	Process	Exocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	TAS	18538446
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	18538446
GO:0007498	Process	Mesoderm development	TAS	3453117
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	10092522
GO:0008289	Function	Lipid binding	EXP	31877324
GO:0008360	Process	Regulation of cell shape	IMP	10092522
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IMP	11904303
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	10092522
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	18538446
GO:0030133	Component	Transport vesicle	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	TAS	18538446
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	TAS	18538446
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	11904303
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	11904303
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17535448
GO:0043299	Process	Leukocyte degranulation	TAS	18538446
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045728	Process	Respiratory burst after phagocytosis	TAS	18538446
GO:0046777	Process	Protein autophosphorylation	IMP	10092522
GO:0050727	Process	Regulation of inflammatory response	TAS	18538446
GO:0050764	Process	Regulation of phagocytosis	IMP	11904303
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IMP	17535448
GO:0060333	Process	Type II interferon-mediated signaling pathway	TAS	18538446
GO:0070161	Component	Anchoring junction	IEA
GO:0071396	Process	Cellular response to lipid	IEA
GO:0071801	Process	Regulation of podosome assembly	IDA	15998323

MIM	HGNC	e!Ensembl
142370	4840	ENSG00000101336

Protein

UniProt ID

P08631

Protein name

Tyrosine-protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59-HCK/p60-HCK) (p59Hck) (p61Hck)

Protein function

Non-receptor tyrosine-protein kinase found in hematopoietic cells that transmits signals from cell surface receptors and plays an important role in the regulation of innate immune responses, including neutrophil, monocyte, macrophage and mast ce

PDB

1AD5 , 1BU1 , 1QCF , 2C0I , 2C0O , 2C0T , 2HCK , 2HK5 , 2OI3 , 2OJ2 , 3HCK , 3NHN , 3RBB , 3REA , 3REB , 3VRY , 3VRZ , 3VS0 , 3VS1 , 3VS2 , 3VS3 , 3VS4 , 3VS5 , 3VS6 , 3VS7 , 4HCK , 4LUD , 4LUE , 4ORZ , 4U5W , 5H09 , 5H0B , 5H0E , 5H0G , 5H0H , 5HCK , 5NUH , 5ZJ6 , 8F2P , 9BYJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	84 → 130	SH3 domain	Domain
PF00017	SH2	144 → 226	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	262 → 511	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in monocytes and neutrophils (at protein level). Expressed predominantly in cells of the myeloid and B-lymphoid lineages. Highly expressed in granulocytes. Detected in tonsil. {ECO:0000269|PubMed:3453117, ECO:0000269|PubMed:80

Sequence

MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP

Sequence length

526

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Fc gamma R-mediated phagocytosis Kaposi sarcoma-associated herpesvirus infection		Nef and signal transduction FCGR activation Regulation of signaling by CBL FCGR3A-mediated IL10 synthesis FCGR3A-mediated phagocytosis

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	17893228
Adenoma	Associate	35221332
Astrocytoma	Associate	24650279
Atherosclerosis	Associate	34925641
Atrial Fibrillation	Associate	35919038
Breast Neoplasms	Associate	33162805
Carcinogenesis	Associate	37342066
Cell Transformation Viral	Associate	19211505
Colorectal Neoplasms	Associate	30684564, 35221332
Diabetes Mellitus	Associate	37773841
Diabetic Nephropathies	Stimulate	36568106
Diabetic Retinopathy	Associate	37773794
Hematologic Neoplasms	Associate	27840303
Inflammation	Associate	30684564, 35280440
Leukemia	Associate	10658677, 27840303, 3496523
Leukemia Myeloid	Associate	31273084, 3496523
Leukemia Myeloid Acute	Associate	1825181, 26785729, 27840303, 31790499, 32226298, 3496523, 35280440
Lymphoma	Associate	35255496
Lymphoma B Cell	Associate	31935288
Lymphoma Large B Cell Diffuse	Associate	27143257
Lymphoma Mantle Cell	Associate	32591642
Lymphoma T Cell Cutaneous	Associate	19211505
Melanoma	Associate	35135212
Mucocutaneous Lymph Node Syndrome	Associate	36536067
Multiple Myeloma	Associate	15010462
Myelodysplastic Syndromes	Associate	27840303
Myeloproliferative Disorders	Associate	3496523
Neoplasms	Associate	19036015, 25774687, 30684564, 32442913, 33162805, 35280440, 37201466, 37342066, 37967237, 7949181
Ovarian Neoplasms	Associate	35761259, 37342066
Pancreatic Neoplasms	Associate	17233815, 33213062
Polyps	Associate	35221332
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10658677
Pulmonary Disease Chronic Obstructive	Associate	22185326
Squamous Cell Carcinoma of Head and Neck	Associate	24192080
Squamous Cell Carcinoma of Head and Neck	Stimulate	37201466
Stomach Neoplasms	Associate	38425243
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	16999846
Thyroid Cancer Papillary	Associate	35185791
Waldenstrom Macroglobulinemia	Associate	27143257, 33764527

HCK (HCK proto-oncogene, Src family tyrosine kinase)