HBZ (hemoglobin subunit zeta)

Gene

• Entrez ID: 3050
• Gene name: Hemoglobin subunit zeta
• Gene symbol: HBZ
• Synonyms (NCBI Gene): HBAZ, HBZ-T1, HBZ1
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluste

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	22696638

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005344	Function	Oxygen carrier activity	IBA
GO:0005344	Function	Oxygen carrier activity	IEA
GO:0005344	Function	Oxygen carrier activity	TAS	7555018
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	6683087, 11159543, 25416956, 25502805, 31515488, 32296183
GO:0005833	Component	Hemoglobin complex	IBA
GO:0005833	Component	Hemoglobin complex	IEA
GO:0005833	Component	Hemoglobin complex	IPI	6683087, 11159543, 24100324
GO:0005833	Component	Hemoglobin complex	TAS	7555018
GO:0015670	Process	Carbon dioxide transport	NAS	7543751, 11159543
GO:0015671	Process	Oxygen transport	IBA
GO:0015671	Process	Oxygen transport	IDA	7543751, 11159543
GO:0015671	Process	Oxygen transport	IEA
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0031838	Component	Haptoglobin-hemoglobin complex	IBA
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048821	Process	Erythrocyte development	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 142310
• HGNC: 4835
• e!Ensembl: ENSG00000130656

Protein

• UniProt ID: P02008
• Protein name: Hemoglobin subunit zeta (HBAZ) (Hemoglobin zeta chain) (Zeta-globin)
• Protein function: The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
• PDB: 1JEB, 3W4U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00042	Globin	7 → 107	Globin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in fetal erythrocytes (at protein level). {ECO:0000269|PubMed:6171809, ECO:0000269|PubMed:6539334}.
• Sequence:

  MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHG
  SKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTA
  EAHAAWDKFLSVVSSVLTEKYR

• Sequence length: 142

<