H2BC5 (H2B clustered histone 5)

Gene

• Entrez ID: 3017
• Gene name: H2B clustered histone 5
• Gene symbol: H2BC5
• Synonyms (NCBI Gene): H2B.1B, H2B/a, H2B/b, H2B/g, H2B/h, H2B/k, H2B/l, H2BFA, H2BFB, H2BFG, H2BFH, H2BFK, H2BFL, HIRIP2, HIST1H2BC, HIST1H2BD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BI, dJ221C16.6
• Chromosome: 6
• Chromosome location: 6p22.2
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 30021884, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	16319397
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337

Other IDs

• MIM: 602799
• HGNC: 4747
• e!Ensembl: ENSG00000158373

Protein

• UniProt ID: P58876
• Protein name: Histone H2B type 1-D (H2B-clustered histone 5) (HIRA-interacting protein 2) (Histone H2B.1 B) (Histone H2B.b) (H2B/b)
• Protein function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00125	Histone	2 → 102	Core histone H2A/H2B/H3/H4	Domain

• Sequence:

  MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
  GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
  KYTSSK

• Sequence length: 126

Pathways

KEGG:

Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus

Reactome:

Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Packaging Of Telomere Ends
Formation of the beta-catenin:TCF transactivating complex
PRC2 methylates histones and DNA
Condensation of Prophase Chromosomes
Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
DNA Damage/Telomere Stress Induced Senescence
HDACs deacetylate histones
HATs acetylate histones
SIRT1 negatively regulates rRNA expression
NoRC negatively regulates rRNA expression
B-WICH complex positively regulates rRNA expression
Transcriptional regulation by small RNAs
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Ub-specific processing proteases
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Nonhomologous End-Joining (NHEJ)
Processing of DNA double-strand break ends
Deposition of new CENPA-containing nucleosomes at the centromere
G2/M DNA damage checkpoint
RNA Polymerase I Promoter Opening
RNA Polymerase I Promoter Escape
E3 ubiquitin ligases ubiquitinate target proteins
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Estrogen-dependent gene expression
HCMV Early Events
HCMV Late Events
Amyloid fiber formation