H1-5 (H1.5 linker histone, cluster member)

Gene

• Entrez ID: 3009
• Gene name: H1.5 linker histone, cluster member
• Gene symbol: H1-5
• Synonyms (NCBI Gene): H1, H1.5, H1B, H1F5, H1s-3, HIST1H1B
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	22956909
GO:0000785	Component	Chromatin	IDA	19882353, 22956909
GO:0000785	Component	Chromatin	IEA
GO:0000786	Component	Nucleosome	IEA
GO:0000791	Component	Euchromatin	IBA
GO:0000792	Component	Heterochromatin	IDA	15911621
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	26496610, 30021884, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21383955
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0006325	Process	Chromatin organization	IMP	22956909
GO:0006334	Process	Nucleosome assembly	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0030261	Process	Chromosome condensation	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031490	Function	Chromatin DNA binding	IMP	15911621, 22956909
GO:0031492	Function	Nucleosomal DNA binding	IBA
GO:0042826	Function	Histone deacetylase binding	IPI	22956909
GO:0045910	Process	Negative regulation of DNA recombination	IBA
GO:0050821	Process	Protein stabilization	IMP	22956909
GO:0071169	Process	Establishment of protein localization to chromatin	IMP	22956909

Other IDs

• MIM: 142711
• HGNC: 4719
• e!Ensembl: ENSG00000184357

Protein

• UniProt ID: P16401
• Protein name: Histone H1.5 (Histone H1a) (Histone H1b) (Histone H1s-3)
• Protein function: Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Also acts as a
• PDB: 2RHI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00538	Linker_histone	40 → 111	linker histone H1 and H5 family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expressed in the majority of the cell lines tested and in testis. {ECO:0000269|PubMed:9031620}.
• Sequence:

  MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGL
  SLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAK
  PKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAA
  AKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK

• Sequence length: 226

Pathways

Reactome:

Apoptosis induced DNA fragmentation
Formation of Senescence-Associated Heterochromatin Foci (SAHF)