Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3008
Gene name Gene Name - the full gene name approved by the HGNC.
H1.4 linker histone, cluster member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
H1-4
Synonyms (NCBI Gene) Gene synonyms aliases
H1.4, H1E, H1F4, H1s-4, HIST1H1E, RMNS, dJ221C16.5
Disease Acronyms (UniProt) Disease acronyms from UniProt database
RMNS
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IEA
GO:0000792 Component Heterochromatin IDA 15911621
GO:0003690 Function Double-stranded DNA binding IBA 21873635
GO:0003723 Function RNA binding HDA 22681889
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142220 4718 ENSG00000168298
Protein
UniProt ID P10412
Protein name Histone H1.4 (Histone H1b) (Histone H1s-4)
Protein function Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Also acts as a
PDB 3TZD , 5JJZ , 6H8P , 7K5Y , 7K63 , 7PET , 7PEU , 7PEX , 7PEZ , 7PF0 , 7PF2 , 7PF3 , 7PF5 , 7PF6 , 7PFA , 7PFC , 7PFD , 7PFE , 7PFT , 7PFU , 7PFV , 7PFW , 7PFX , 8H1T , 8VG2 , 9DDE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00538 Linker_histone 37 108 linker histone H1 and H5 family Domain
Sequence
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN
KKAASGEAKPKA
KKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK
PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK
Sequence length 219
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Apoptosis induced DNA fragmentation
Formation of Senescence-Associated Heterochromatin Foci (SAHF)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 23685749
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Macrocephaly Macrocephaly rs786204854, rs764333096, rs1557739557
Unknown
Disease term Disease name Evidence References Source
RAHMAN SYNDROME Rahman syndrome GenCC