H1-0 (H1.0 linker histone)

Gene

• Entrez ID: 3005
• Gene name: H1.0 linker histone
• Gene symbol: H1-0
• Synonyms (NCBI Gene): H1.0, H10, H1F0, H1FV
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	19882353
GO:0000786	Component	Nucleosome	IEA
GO:0000791	Component	Euchromatin	IDA	15911621
GO:0003677	Function	DNA binding	IEA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	9499053, 26503038, 29466338, 30021884, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21383955
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016604	Component	Nuclear body	IDA
GO:0017053	Component	Transcription repressor complex	IDA	19158276
GO:0030261	Process	Chromosome condensation	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	15911621
GO:0031491	Function	Nucleosome binding	IPI	35377618
GO:0031492	Function	Nucleosomal DNA binding	IBA
GO:0031507	Process	Heterochromatin formation	IGI	19158276
GO:0045910	Process	Negative regulation of DNA recombination	IBA
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IMP	19158276

Other IDs

• MIM: 142708
• HGNC: 4714
• e!Ensembl: ENSG00000189060

Protein

• UniProt ID: P07305
• Protein name: Histone H1.0 (Histone H1') (Histone H1(0)) [Cleaved into: Histone H1.0, N-terminally processed]
• Protein function: Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The histones H1.0 are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
• PDB: 6HQ1, 6LA2, 6LA8, 6LA9, 6LAB, 6N88, 6N89, 7COW, 7DBP, 7K5X, 7XVL, 7XX6, 8TB9, 9IPU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00538	Linker_histone	25 → 96	linker histone H1 and H5 family	Domain

• Sequence:

  MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
  GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
  KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
  PKAKSSAKRAGKKK

• Sequence length: 194

Pathways

Reactome:

Apoptosis induced DNA fragmentation
Formation of Senescence-Associated Heterochromatin Foci (SAHF)