Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	30012
Gene name Gene Name - the full gene name approved by the HGNC.	T cell leukemia homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TLX3
Synonyms (NCBI Gene) Gene synonyms aliases	HOX11L2, RNX
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and y

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018007	hsa-miR-335-5p	Microarray	18185580
MIRT029503	hsa-miR-26b-5p	Microarray	19088304
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT1427078	hsa-miR-1538	CLIP-seq
MIRT1427079	hsa-miR-1972	CLIP-seq
MIRT1427080	hsa-miR-2861	CLIP-seq
MIRT1427081	hsa-miR-3160-5p	CLIP-seq
MIRT1427082	hsa-miR-3655	CLIP-seq
MIRT1427083	hsa-miR-4315	CLIP-seq
MIRT1427084	hsa-miR-4650-5p	CLIP-seq
MIRT1427085	hsa-miR-4745-3p	CLIP-seq
MIRT1427086	hsa-miR-4747-3p	CLIP-seq
MIRT1427087	hsa-miR-578	CLIP-seq
MIRT1427088	hsa-miR-661	CLIP-seq
MIRT2127957	hsa-miR-3180	CLIP-seq
MIRT2127958	hsa-miR-3180-3p	CLIP-seq
MIRT2127959	hsa-miR-3196	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001764	Process	Neuron migration	IEA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	22516263, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007417	Process	Central nervous system development	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0048665	Process	Neuron fate specification	IEA
GO:0097154	Process	GABAergic neuron differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604640	13532	ENSG00000164438

Protein

UniProt ID

O43711

Protein name

T-cell leukemia homeobox protein 3 (Homeobox protein Hox-11L2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	167 → 223	Homeodomain	Domain

Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV

Sequence length

291

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Stimulate	35562412
Acute cholinergic dysautonomia	Associate	29453933
Adenocarcinoma of Lung	Associate	24369052
Adenoma Islet Cell	Stimulate	30575306
Ataxia Telangiectasia	Associate	12086890, 39940843
Dystonia Dopa responsive	Stimulate	36947815
Leukemia	Associate	22366949, 36947815
Leukemia	Stimulate	37060567
Lymphoma	Associate	39984035
Lymphoma T Cell	Associate	14504110, 35562412
Neoplasms	Associate	16207477, 23637834
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	12130513, 14504110, 15054041, 22516263, 22563559
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	14604958, 15774621, 18492690, 19494353, 19835636, 20065082, 20124220, 22366949, 28151996, 29746601, 32142900, 33259601, 35562412, 37060567, 39984035
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	16926283, 18835836
Prostatitis	Associate	16207477

TLX3 (T cell leukemia homeobox 3)