Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	30012
Gene name	T cell leukemia homeobox 3
Gene symbol	TLX3
Synonyms (NCBI Gene)	HOX11L2RNX
Chromosome	5
Chromosome location	5q35.1
Summary	The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and y

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018007	hsa-miR-335-5p	Microarray	18185580
MIRT029503	hsa-miR-26b-5p	Microarray	19088304
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT442278	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT442277	hsa-miR-3133	PAR-CLIP	22100165
MIRT442276	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT442275	hsa-miR-1323	PAR-CLIP	22100165
MIRT442274	hsa-miR-548o-3p	PAR-CLIP	22100165
MIRT442273	hsa-miR-4744	PAR-CLIP	22100165
MIRT442272	hsa-miR-4509	PAR-CLIP	22100165
MIRT442271	hsa-miR-4799-5p	PAR-CLIP	22100165
MIRT442270	hsa-miR-4263	PAR-CLIP	22100165
MIRT442269	hsa-miR-576-5p	PAR-CLIP	22100165
MIRT1427078	hsa-miR-1538	CLIP-seq
MIRT1427079	hsa-miR-1972	CLIP-seq
MIRT1427080	hsa-miR-2861	CLIP-seq
MIRT1427081	hsa-miR-3160-5p	CLIP-seq
MIRT1427082	hsa-miR-3655	CLIP-seq
MIRT1427083	hsa-miR-4315	CLIP-seq
MIRT1427084	hsa-miR-4650-5p	CLIP-seq
MIRT1427085	hsa-miR-4745-3p	CLIP-seq
MIRT1427086	hsa-miR-4747-3p	CLIP-seq
MIRT1427087	hsa-miR-578	CLIP-seq
MIRT1427088	hsa-miR-661	CLIP-seq
MIRT2127957	hsa-miR-3180	CLIP-seq
MIRT2127958	hsa-miR-3180-3p	CLIP-seq
MIRT2127959	hsa-miR-3196	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001764	Process	Neuron migration	IEA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	22516263, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007417	Process	Central nervous system development	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0048665	Process	Neuron fate specification	IEA
GO:0097154	Process	GABAergic neuron differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604640	13532	ENSG00000164438

O43711

Protein name

T-cell leukemia homeobox protein 3 (Homeobox protein Hox-11L2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	167 → 223	Homeodomain	Domain

Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV

Sequence length

291

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Stimulate	35562412	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute cholinergic dysautonomia	Associate	29453933	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	24369052	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma Islet Cell	Stimulate	30575306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Associate	12086890, 39940843	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Dopa responsive	Stimulate	36947815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	22366949, 36947815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Stimulate	37060567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	39984035	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	14504110, 35562412	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16207477, 23637834	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	12130513, 14504110, 15054041, 22516263, 22563559	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	14604958, 15774621, 18492690, 19494353, 19835636, 20065082, 20124220, 22366949, 28151996, 29746601, 32142900, 33259601, 35562412, 37060567, 39984035	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	16926283, 18835836	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	16207477	★★★★★ ★☆☆☆☆ Found in Text Mining only

TLX3 (T cell leukemia homeobox 3)