Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30012
Gene name Gene Name - the full gene name approved by the HGNC.
T cell leukemia homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLX3
Synonyms (NCBI Gene) Gene synonyms aliases
HOX11L2, RNX
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and y
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018007 hsa-miR-335-5p Microarray 18185580
MIRT029503 hsa-miR-26b-5p Microarray 19088304
MIRT442278 hsa-miR-5582-3p PAR-CLIP 22100165
MIRT442277 hsa-miR-3133 PAR-CLIP 22100165
MIRT442276 hsa-miR-186-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001764 Process Neuron migration IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604640 13532 ENSG00000164438
Protein
UniProt ID O43711
Protein name T-cell leukemia homeobox protein 3 (Homeobox protein Hox-11L2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 167 223 Homeodomain Domain
Sequence
MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRR
QTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Transcriptional misregulation in cancer  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Restless Legs Syndrome Restless legs syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Stimulate 35562412
Acute cholinergic dysautonomia Associate 29453933
Adenocarcinoma of Lung Associate 24369052
Adenoma Islet Cell Stimulate 30575306
Ataxia Telangiectasia Associate 12086890, 39940843
Dystonia Dopa responsive Stimulate 36947815
Leukemia Associate 22366949, 36947815
Leukemia Stimulate 37060567
Lymphoma Associate 39984035
Lymphoma T Cell Associate 14504110, 35562412