Gene Gene information from NCBI Gene database.
Entrez ID 30011
Gene name SH3 domain containing kinase binding protein 1
Gene symbol SH3KBP1
Synonyms (NCBI Gene)
AGMX2CD2BP3CIN85GIG10HSB-1HSB1IMD61MIG18
Chromosome X
Chromosome location Xp22.12
Summary This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cel
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1602794694 C>G Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
198
miRTarBase ID miRNA Experiments Reference
MIRT035790 hsa-miR-1914-5p CLASH 23622248
MIRT613683 hsa-miR-548az-5p HITS-CLIP 23824327
MIRT613682 hsa-miR-548t-5p HITS-CLIP 23824327
MIRT613681 hsa-miR-3609 HITS-CLIP 23824327
MIRT613680 hsa-miR-548ah-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10679202, 12177062, 14596919, 15090612, 15962011, 16164598, 16228008, 16256071, 16751601, 17255943, 17306257, 18641129, 18680311, 19111555, 19268472, 20221403, 20551902, 20711168, 21516116, 21900206, 23178720, 23663663, 25036637, 28514442, 31413325, 31980649, 32296183, 32814053, 339
GO:0005737 Component Cytoplasm IDA 20221403, 25468996
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300374 13867 ENSG00000147010
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96B97
Protein name SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)
Protein function Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor recepto
PDB 2BZ8 , 2K6D , 2K9G , 2N64 , 2O2O , 2YDL , 5ABS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14604 SH3_9 6 54 Variant SH3 domain Domain
PF14604 SH3_9 105 153 Variant SH3 domain Domain
PF14604 SH3_9 274 324 Variant SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Also expressed in some cancer cell lines.
Sequence
MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM
KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIK
ELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVK
LLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS
QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK
Sequence length 665
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocytosis   EGFR downregulation
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Reelin signalling pathway
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
32
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs3747357, rs7883994 RCV005914155
RCV005911296
Cholangiocarcinoma Benign rs7883994 RCV005911298
Gastric cancer Benign rs7883994 RCV005911297
Immunodeficiency 61 Benign; Likely benign rs2290805 RCV002488319
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Psoriatic Associate 34344401
Breast Neoplasms Associate 17255943, 33627783
Carcinogenesis Associate 33627783
Esophageal Squamous Cell Carcinoma Associate 33179079
Genetic Diseases X Linked Associate 29636373
Immunologic Deficiency Syndromes Associate 29636373
Lymphatic Metastasis Stimulate 33179079
Lymphoma B Cell Associate 33627783
Nasopharyngeal Carcinoma Associate 29582644
Neoplasms Associate 17255943, 20927317, 23279575, 33179079