Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30011
Gene name Gene Name - the full gene name approved by the HGNC.
SH3 domain containing kinase binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SH3KBP1
Synonyms (NCBI Gene) Gene synonyms aliases
AGMX2, CD2BP3, CIN85, GIG10, HSB-1, HSB1, IMD61, MIG18
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD61
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp22.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cel
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1602794694 C>G Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT035790 hsa-miR-1914-5p CLASH 23622248
MIRT613683 hsa-miR-548az-5p HITS-CLIP 23824327
MIRT613682 hsa-miR-548t-5p HITS-CLIP 23824327
MIRT613681 hsa-miR-3609 HITS-CLIP 23824327
MIRT613680 hsa-miR-548ah-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10679202, 12177062, 14596919, 15090612, 15962011, 16164598, 16256071, 16751601, 17255943, 17306257, 18641129, 18680311, 19111555, 19268472, 20221403, 20551902, 20711168, 21516116, 21900206, 23178720, 23663663, 25036637, 28514442, 31413325, 31980649, 32296183, 32814053
GO:0005737 Component Cytoplasm IDA 20221403, 25468996
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300374 13867 ENSG00000147010
Protein
UniProt ID Q96B97
Protein name SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)
Protein function Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor recepto
PDB 2BZ8 , 2K6D , 2K9G , 2N64 , 2O2O , 2YDL , 5ABS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14604 SH3_9 6 54 Variant SH3 domain Domain
PF14604 SH3_9 105 153 Variant SH3 domain Domain
PF14604 SH3_9 274 324 Variant SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Also expressed in some cancer cell lines.
Sequence
MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM
KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIK
ELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVK
LLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS
QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK
Sequence length 665
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis   EGFR downregulation
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Reelin signalling pathway
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agammaglobulinemia Agammaglobulinemia rs2134166251, rs128620183, rs128620185, rs128621193, rs128621201, rs128621204, rs121912424, rs267606711, rs376256147, rs281865422, rs1600631593, rs1555843601, rs267606871, rs879255271, rs2142904392
View all (17 more)
Agammaglobulinemia, x-linked AGAMMAGLOBULINEMIA, X-LINKED, TYPE 2 (disorder) rs128620183, rs128620184, rs128620187, rs128620188, rs128620185, rs128620186, rs128620189, rs864321660, rs864321661, rs864321662, rs864321663, rs128621190, rs864321664, rs864321665, rs1569293253
View all (60 more)
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Unknown
Disease term Disease name Evidence References Source
Otitis media Recurrent otitis media ClinVar
Immunodeficiency immunodeficiency 61 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Psoriatic Associate 34344401
Breast Neoplasms Associate 17255943, 33627783
Carcinogenesis Associate 33627783
Esophageal Squamous Cell Carcinoma Associate 33179079
Genetic Diseases X Linked Associate 29636373
Immunologic Deficiency Syndromes Associate 29636373
Lymphatic Metastasis Stimulate 33179079
Lymphoma B Cell Associate 33627783
Nasopharyngeal Carcinoma Associate 29582644
Neoplasms Associate 17255943, 20927317, 23279575, 33179079