Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	30010
Gene name Gene Name - the full gene name approved by the HGNC.	Neurexophilin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NXPH1
Synonyms (NCBI Gene) Gene synonyms aliases	NPH1, Nbla00697
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the neurexophilin family and encodes a secreted protein with a variable N-terminal domain, a highly conserved, N-glycosylated central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein forms a very

Show/Hide all(89)

miRTarBase ID	miRNA	Experiments
MIRT1200546	hsa-let-7a	CLIP-seq
MIRT1200547	hsa-let-7b	CLIP-seq
MIRT1200548	hsa-let-7c	CLIP-seq
MIRT1200549	hsa-let-7d	CLIP-seq
MIRT1200550	hsa-let-7e	CLIP-seq
MIRT1200551	hsa-let-7f	CLIP-seq
MIRT1200552	hsa-let-7g	CLIP-seq
MIRT1200553	hsa-let-7i	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200555	hsa-miR-1287	CLIP-seq
MIRT1200556	hsa-miR-1304	CLIP-seq
MIRT1200557	hsa-miR-1305	CLIP-seq
MIRT1200558	hsa-miR-146b-3p	CLIP-seq
MIRT1200559	hsa-miR-194	CLIP-seq
MIRT1200560	hsa-miR-202	CLIP-seq
MIRT1200561	hsa-miR-3065-5p	CLIP-seq
MIRT1200562	hsa-miR-3135b	CLIP-seq
MIRT1200563	hsa-miR-3148	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200565	hsa-miR-3194-3p	CLIP-seq
MIRT1200566	hsa-miR-323-3p	CLIP-seq
MIRT1200567	hsa-miR-339-5p	CLIP-seq
MIRT1200568	hsa-miR-3613-5p	CLIP-seq
MIRT1200569	hsa-miR-3924	CLIP-seq
MIRT1200570	hsa-miR-409-3p	CLIP-seq
MIRT1200571	hsa-miR-421	CLIP-seq
MIRT1200572	hsa-miR-4427	CLIP-seq
MIRT1200573	hsa-miR-4458	CLIP-seq
MIRT1200574	hsa-miR-4500	CLIP-seq
MIRT1200575	hsa-miR-4659a-3p	CLIP-seq
MIRT1200576	hsa-miR-4659b-3p	CLIP-seq
MIRT1200577	hsa-miR-4680-3p	CLIP-seq
MIRT1200578	hsa-miR-4728-3p	CLIP-seq
MIRT1200579	hsa-miR-4778-3p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200582	hsa-miR-568	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200584	hsa-miR-759	CLIP-seq
MIRT1200585	hsa-miR-875-3p	CLIP-seq
MIRT1200586	hsa-miR-98	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT2058022	hsa-miR-587	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200584	hsa-miR-759	CLIP-seq
MIRT1200546	hsa-let-7a	CLIP-seq
MIRT1200547	hsa-let-7b	CLIP-seq
MIRT1200548	hsa-let-7c	CLIP-seq
MIRT1200549	hsa-let-7d	CLIP-seq
MIRT1200550	hsa-let-7e	CLIP-seq
MIRT1200551	hsa-let-7f	CLIP-seq
MIRT1200552	hsa-let-7g	CLIP-seq
MIRT1200553	hsa-let-7i	CLIP-seq
MIRT2286411	hsa-miR-1248	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200556	hsa-miR-1304	CLIP-seq
MIRT1200559	hsa-miR-194	CLIP-seq
MIRT1200560	hsa-miR-202	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200573	hsa-miR-4458	CLIP-seq
MIRT1200574	hsa-miR-4500	CLIP-seq
MIRT1200575	hsa-miR-4659a-3p	CLIP-seq
MIRT1200576	hsa-miR-4659b-3p	CLIP-seq
MIRT1200579	hsa-miR-4778-3p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT2058022	hsa-miR-587	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT2286412	hsa-miR-642b	CLIP-seq
MIRT1200586	hsa-miR-98	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT2584401	hsa-miR-338-5p	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0043083	Component	Synaptic cleft	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA

MIM	HGNC	e!Ensembl
604639	20693	ENSG00000122584

Protein

UniProt ID

P58417

Protein name

Neurexophilin-1

Protein function

May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06312	Neurexophilin	63 → 271	Neurexophilin	Family

Sequence

MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG
WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ
QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI
YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Sequence length

271

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast cancer	Breast Cancer in BRCA1 mutation carriers	N/A	N/A	GWAS
Lung adenocarcinoma	Lung adenocarcinoma (survival time) in never smokers	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	20100581
Autistic Disorder	Associate	22016809
Diabetes Mellitus	Associate	28068899
Nephronophthisis familial juvenile	Associate	17601928
Neuroblastoma	Associate	26646589
Obesity	Associate	28068899
Pancreatic Intraductal Neoplasms	Associate	22173550
Retinal Dysplasia	Associate	22173550
Trigeminal Neuralgia	Associate	38158702

NXPH1 (neurexophilin 1)