Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30009
Gene name Gene Name - the full gene name approved by the HGNC.
T-box transcription factor 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TBX21
Synonyms (NCBI Gene) Gene synonyms aliases
IMD88, T-PET, T-bet, TBET, TBLYM
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mou
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007033 hsa-miR-29b-3p Luciferase reporter assay 22772450
MIRT1415137 hsa-miR-1289 CLIP-seq
MIRT1415138 hsa-miR-3198 CLIP-seq
MIRT1415139 hsa-miR-3942-3p CLIP-seq
MIRT1415140 hsa-miR-4294 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 17407192
RELA Activation 17407192
SP1 Unknown 17075044
STAT1 Unknown 18414429
STAT4 Unknown 19923468
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18504404
GO:0000785 Component Chromatin IBA
GO:0000976 Function Transcription cis-regulatory region binding IDA 19805038
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604895 11599 ENSG00000073861
Protein
UniProt ID Q9UL17
Protein name T-box transcription factor TBX21 (T-box protein 21) (T-cell-specific T-box transcription factor T-bet) (Transcription factor TBLYM)
Protein function Lineage-defining transcription factor which initiates Th1 lineage development from naive Th precursor cells both by activating Th1 genetic programs and by repressing the opposing Th2 and Th17 genetic programs (PubMed:10761931). Activates transcr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00907 T-box 139 326 T-box Domain
Tissue specificity TISSUE SPECIFICITY: T-cell specific. {ECO:0000269|PubMed:10761931}.
Sequence
MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPG
GALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHIFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRE
NFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLP
NQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEI
APIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
Sequence length 535
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Th1 and Th2 cell differentiation
Th17 cell differentiation
Inflammatory bowel disease
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, aspirin-induced, susceptibility to, Asthma, nasal polyps, and aspirin intolerance, Age of onset of adult onset asthma, Asthma in any disease, Asthma, Asthma (childhood onset) N/A N/A ClinVar, GWAS
Dementia Dementia N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Stimulate 37035756
Achalasia Addisonianism Alacrimia syndrome Stimulate 37980558
Adenocarcinoma Associate 36281585
Adenocarcinoma of Lung Associate 26348446
Adenocarcinoma of Lung Inhibit 31909418
Alopecia Areata Stimulate 26551570
Alzheimer Disease Associate 36405736
Anemia Aplastic Stimulate 16434488
Anemia Aplastic Associate 37980558
Arthritis Associate 20679229