Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29997
Gene name Gene Name - the full gene name approved by the HGNC.	NOP53 ribosome biogenesis factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NOP53
Synonyms (NCBI Gene) Gene synonyms aliases	GLTSCR2, PICT-1, PICT1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT635930	hsa-miR-548ac	HITS-CLIP	23824327
MIRT635929	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT635928	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT635927	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT635926	hsa-miR-548z	HITS-CLIP	23824327
MIRT635925	hsa-miR-548aa	HITS-CLIP	23824327
MIRT635924	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT635923	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT635922	hsa-miR-3617-5p	HITS-CLIP	23824327
MIRT635921	hsa-miR-641	HITS-CLIP	23824327
MIRT635920	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT635919	hsa-miR-4457	HITS-CLIP	23824327
MIRT635918	hsa-miR-125b-2-3p	HITS-CLIP	23824327
MIRT635917	hsa-miR-513b-5p	HITS-CLIP	23824327

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000027	Process	Ribosomal large subunit assembly	IBA	21873635
GO:0000027	Process	Ribosomal large subunit assembly	IMP	24120868
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	25956029
GO:0001650	Component	Fibrillar center	IDA	27729611
GO:0001932	Process	Regulation of protein phosphorylation	IMP	15355975
GO:0002039	Function	P53 binding	IPI	22522597
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	15355975, 20042497, 21167305, 24556985, 25956029, 27323397, 27729611, 27824081, 27829214, 28514442, 32296183
GO:0005654	Component	Nucleoplasm	IDA	22522597, 24923447, 27323397
GO:0005730	Component	Nucleolus	IBA	21873635
GO:0005730	Component	Nucleolus	IDA	20042497, 22522597, 24923447, 25956029, 27323397, 27829214
GO:0005829	Component	Cytosol	IDA	24923447
GO:0006281	Process	DNA repair	IMP	21741933
GO:0006364	Process	RRNA processing	IBA	21873635
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	27829214
GO:0007095	Process	Mitotic G2 DNA damage checkpoint	IMP	21741933
GO:0008097	Function	5S rRNA binding	IBA	21873635
GO:0008097	Function	5S rRNA binding	IDA	24120868
GO:0014067	Process	Negative regulation of phosphatidylinositol 3-kinase signaling	IMP	16971513
GO:0016032	Process	Viral process	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	25956029
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	22522597
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25818168, 27323397
GO:0033553	Component	RDNA heterochromatin	IDA	27729611
GO:0039535	Process	Regulation of RIG-I signaling pathway	IMP	27824081
GO:0042802	Function	Identical protein binding	IDA	24735870
GO:0042981	Process	Regulation of apoptotic process	IMP	21167305
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0050821	Process	Protein stabilization	IMP	15355975
GO:0051726	Process	Regulation of cell cycle	IMP	21167305
GO:0051898	Process	Negative regulation of protein kinase B signaling	IMP	27729611
GO:0071456	Process	Cellular response to hypoxia	IMP	22522597
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IMP	22522597, 24120868, 24556985, 27829214
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IEA
GO:1901837	Process	Negative regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	27729611
GO:1902570	Process	Protein localization to nucleolus	IEA
GO:1903006	Process	Positive regulation of protein K63-linked deubiquitination	IMP	27824081
GO:1903715	Process	Regulation of aerobic respiration	IMP	24556985
GO:1990173	Process	Protein localization to nucleoplasm	IMP	25818168, 27323397

MIM	HGNC	e!Ensembl
605691	4333	ENSG00000105373

Protein

UniProt ID

Q9NZM5

Protein name

Ribosome biogenesis protein NOP53 (Glioma tumor suppressor candidate region gene 2 protein) (Protein interacting with carboxyl terminus 1) (PICT-1) (p60)

Protein function

Nucleolar protein which is involved in the integration of the 5S RNP into the ribosomal large subunit during ribosome biogenesis (PubMed:24120868). In ribosome biogenesis, may also play a role in rRNA transcription (PubMed:27729611). Also functi

PDB

8FKZ , 8FL2 , 8FL3 , 8FL4 , 8FL6 , 8FL7 , 8FLA , 8FLB , 8FLD , 8FLE , 8INE , 8INF , 8IPX , 8IPY , 8IR3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07767	Nop53	41 → 445	Nop53 (60S ribosomal biogenesis)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in heart and pancreas, moderate levels in placenta, liver, skeletal muscle, and kidney, and low levels in brain and lung. {ECO:0000269|PubMed:10708517}.

Sequence

MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAQEPLGLEV
DQFLEDVRLQERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDL
ILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLAKQGELPREVRRAQARLLNPSATRA
KPGPQDTVERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPAVEV
APAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQAATQESTFQELCEG
LLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHRLRVQQAALRA
ARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL

Sequence length

478

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Follicular	Associate	21420716
Carcinogenesis	Associate	22292050, 27323397
Familial medullary thyroid carcinoma	Associate	31703244
Glioblastoma	Associate	22850112
Glioma	Associate	15834925
Glioma	Inhibit	16212814
Glucagonoma	Associate	28921546
Hypoxia	Inhibit	22850112
Neoplasms	Inhibit	21741933, 27323397, 27729611, 28921546, 34166715
Neoplasms	Associate	22292050, 22850112, 24923447
Ovarian Diseases	Associate	19849863
Sacral defect and anterior sacral meningocele	Associate	28007035
Stomach Neoplasms	Associate	24045667
Uterine Cervical Neoplasms	Associate	25818168, 34166715
Virus Diseases	Associate	27824081

NOP53 (NOP53 ribosome biogenesis factor)