NOP53 (NOP53 ribosome biogenesis factor)

Gene

• Entrez ID: 29997
• Gene name: NOP53 ribosome biogenesis factor
• Gene symbol: NOP53
• Synonyms (NCBI Gene): GLTSCR2, PICT-1, PICT1
• Chromosome: 19
• Chromosome location: 19q13.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT635930	hsa-miR-548ac	HITS-CLIP	23824327
MIRT635929	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT635928	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT635927	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT635926	hsa-miR-548z	HITS-CLIP	23824327
MIRT635925	hsa-miR-548aa	HITS-CLIP	23824327
MIRT635924	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT635923	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT635922	hsa-miR-3617-5p	HITS-CLIP	23824327
MIRT635921	hsa-miR-641	HITS-CLIP	23824327
MIRT635920	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT635919	hsa-miR-4457	HITS-CLIP	23824327
MIRT635918	hsa-miR-125b-2-3p	HITS-CLIP	23824327
MIRT635917	hsa-miR-513b-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000027	Process	Ribosomal large subunit assembly	IBA
GO:0000027	Process	Ribosomal large subunit assembly	IMP	24120868
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	25956029
GO:0001650	Component	Fibrillar center	IDA	27729611
GO:0001932	Process	Regulation of protein phosphorylation	IMP	15355975
GO:0002039	Function	P53 binding	IPI	22522597
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	15355975, 20042497, 21167305, 24556985, 25956029, 26618866, 27323397, 27729611, 27824081, 27829214, 28514442, 31694235, 32296183, 32867128, 33961781, 35156780
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	22522597, 24923447, 27323397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	20042497, 22522597, 24923447, 25956029, 27323397, 27829214
GO:0005730	Component	Nucleolus	IEA
GO:0005829	Component	Cytosol	IDA	24923447
GO:0006281	Process	DNA repair	IMP	21741933
GO:0006364	Process	RRNA processing	IBA
GO:0006974	Process	DNA damage response	IMP	27829214
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	21741933
GO:0008097	Function	5S rRNA binding	IBA
GO:0008097	Function	5S rRNA binding	IDA	24120868
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	25956029
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	22522597
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25818168, 27323397
GO:0033553	Component	RDNA heterochromatin	IDA	27729611
GO:0039535	Process	Regulation of RIG-I signaling pathway	IMP	27824081
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042802	Function	Identical protein binding	IDA	24735870
GO:0042981	Process	Regulation of apoptotic process	IMP	21167305
GO:0050821	Process	Protein stabilization	IMP	15355975
GO:0051726	Process	Regulation of cell cycle	IMP	21167305
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	16971513, 27729611
GO:0071456	Process	Cellular response to hypoxia	IMP	22522597
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IMP	22522597, 24120868, 24556985, 27829214
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IEA
GO:1901837	Process	Negative regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	27729611
GO:1902570	Process	Protein localization to nucleolus	IEA
GO:1903006	Process	Positive regulation of protein K63-linked deubiquitination	IMP	27824081
GO:1903715	Process	Regulation of aerobic respiration	IMP	24556985
GO:1990173	Process	Protein localization to nucleoplasm	IMP	25818168, 27323397

Other IDs

• MIM: 605691
• HGNC: 4333
• e!Ensembl: ENSG00000105373

Protein

• UniProt ID: Q9NZM5
• Protein name: Ribosome biogenesis protein NOP53 (Glioma tumor suppressor candidate region gene 2 protein) (Protein interacting with carboxyl terminus 1) (PICT-1) (p60)
• Protein function: Nucleolar protein which is involved in the integration of the 5S RNP into the ribosomal large subunit during ribosome biogenesis (PubMed:24120868). In ribosome biogenesis, may also play a role in rRNA transcription (PubMed:27729611). Also functi
• PDB: 8FKZ, 8FL2, 8FL3, 8FL4, 8FL6, 8FL7, 8FLA, 8FLB, 8FLD, 8FLE, 8INE, 8INF, 8IPX, 8IPY, 8IR3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07767	Nop53	41 → 445	Nop53 (60S ribosomal biogenesis)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in heart and pancreas, moderate levels in placenta, liver, skeletal muscle, and kidney, and low levels in brain and lung. {ECO:0000269|PubMed:10708517}.
• Sequence:

  MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAQEPLGLEV
  DQFLEDVRLQERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDL
  ILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLAKQGELPREVRRAQARLLNPSATRA
  KPGPQDTVERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPAVEV
  APAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQAATQESTFQELCEG
  LLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHRLRVQQAALRA
  ARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL
  SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL

• Sequence length: 478