PILRA (paired immunoglobin like type 2 receptor alpha)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 29992
Gene name Paired immunoglobin like type 2 receptor alpha
Gene symbol PILRA
Synonyms (NCBI Gene)
FDF03
Chromosome 7
Chromosome location 7q22.1
Summary Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory recep
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT1235096 hsa-miR-3934 CLIP-seq
MIRT1235097 hsa-miR-4252 CLIP-seq
MIRT1235098 hsa-miR-5095 CLIP-seq
MIRT1235099 hsa-miR-552 CLIP-seq
MIRT1235100 hsa-miR-933 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10660620, 18358807, 22396535, 30388101
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0007165 Process Signal transduction IDA 10903717
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
605341 20396 ENSG00000085514
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKJ1
Protein name Paired immunoglobulin-like type 2 receptor alpha (Cell surface receptor FDF03) (Inhibitory receptor PILR-alpha)
Protein function Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphat
PDB 3WUZ , 3WV0 , 4NFB , 5XO2 , 5XOF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 → 150 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly detected in hemopoietic tissues and is expressed by monocytes, macrophages, and granulocytes, but not by lymphocytes. Also strongly expressed by dendritic cells (DC); preferentially by CD14+/CD1a- DC derived from CD34+ pr
Sequence 
MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE
LATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQ
SVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRV
TQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQ
NTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSV
LKA
Sequence length 303
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Virion - Herpesvirus
Herpes simplex virus 1 infection 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell