Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29992
Gene name Gene Name - the full gene name approved by the HGNC.
Paired immunoglobin like type 2 receptor alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PILRA
Synonyms (NCBI Gene) Gene synonyms aliases
FDF03
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory recep
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1235096 hsa-miR-3934 CLIP-seq
MIRT1235097 hsa-miR-4252 CLIP-seq
MIRT1235098 hsa-miR-5095 CLIP-seq
MIRT1235099 hsa-miR-552 CLIP-seq
MIRT1235100 hsa-miR-933 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10660620, 18358807, 30388101
GO:0005886 Component Plasma membrane TAS
GO:0007165 Process Signal transduction IDA 10903717
GO:0016021 Component Integral component of membrane IEA
GO:0016032 Process Viral process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605341 20396 ENSG00000085514
Protein
UniProt ID Q9UKJ1
Protein name Paired immunoglobulin-like type 2 receptor alpha (Cell surface receptor FDF03) (Inhibitory receptor PILR-alpha)
Protein function Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphat
PDB 3WUZ , 3WV0 , 4NFB , 5XO2 , 5XOF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 150 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly detected in hemopoietic tissues and is expressed by monocytes, macrophages, and granulocytes, but not by lymphocytes. Also strongly expressed by dendritic cells (DC); preferentially by CD14+/CD1a- DC derived from CD34+ pr
Sequence
MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE
LATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQ
SVYFCRVELDTRSSGRQQWQSIEGTKLSIT
QAVTTTTQRPSSMTTTWRLSSTTTTTGLRV
TQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQ
NTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSV
LKA
Sequence length 303
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Virion - Herpesvirus
Herpes simplex virus 1 infection
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
30617256, 29777097
Age-related macular degeneration Age related macular degeneration rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152
View all (20 more)
26691988
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 24439028, 29181857, 31297637, 33712570, 34602489, 34767070, 35918447, 40050982
Alzheimer Disease Inhibit 35918447
Atrial Fibrillation Associate 38097129
Azoospermia Nonobstructive Associate 29202958
Carcinoma Renal Cell Associate 35120484
Cognition Disorders Associate 31297637
Infections Associate 21139972
Macular Degeneration Associate 24439028
Neoplasms Associate 37652967
Varicose Veins Associate 39341975