OBP2B (odorant binding protein 2B)

Gene

• Entrez ID: 29989
• Gene name: Odorant binding protein 2B
• Gene symbol: OBP2B
• Synonyms (NCBI Gene): LCN14, OBPIIb
• Chromosome: 9
• Chromosome location: 9q34.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1201663	hsa-miR-3155	CLIP-seq
MIRT1201664	hsa-miR-3155b	CLIP-seq
MIRT1201665	hsa-miR-323-5p	CLIP-seq
MIRT1201666	hsa-miR-4645-5p	CLIP-seq
MIRT1201667	hsa-miR-4673	CLIP-seq
MIRT1201668	hsa-miR-484	CLIP-seq
MIRT1201669	hsa-miR-760	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005549	Function	Odorant binding	NAS	10607840
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	NAS	10607840
GO:0007635	Process	Chemosensory behavior	TAS	10607840
GO:0036094	Function	Small molecule binding	IEA

Other IDs

• MIM: 604606
• HGNC: 23381
• e!Ensembl: ENSG00000171102

Protein

• UniProt ID: Q9NPH6
• Protein name: Odorant-binding protein 2b (Odorant-binding protein IIb) (OBPIIb)
• Protein function: Probably binds and transports small hydrophobic volatile molecules.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	26 → 164	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in genital sphere organs such as the prostate and mammary glands.
• Sequence:

  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGG
  KLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHG
  GLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

• Sequence length: 170

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	37895183	★☆☆☆☆ Found in Text Mining only
Glaucoma	Associate	39342991	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	34529670	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33795748	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Associate	37537391	★☆☆☆☆ Found in Text Mining only