Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29985
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 39 member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC39A3
Synonyms (NCBI Gene) Gene synonyms aliases	ZIP-3, ZIP3
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3

Show/Hide all(80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023150	hsa-miR-124-3p	Microarray	18668037
MIRT024059	hsa-miR-1-3p	Microarray	18668037
MIRT1363495	hsa-miR-1538	CLIP-seq
MIRT1363496	hsa-miR-3657	CLIP-seq
MIRT1363497	hsa-miR-4283	CLIP-seq
MIRT1363498	hsa-miR-4508	CLIP-seq
MIRT1363499	hsa-miR-4532	CLIP-seq
MIRT1363500	hsa-miR-4669	CLIP-seq
MIRT1363501	hsa-miR-4745-3p	CLIP-seq
MIRT1363502	hsa-miR-134	CLIP-seq
MIRT1363503	hsa-miR-2467-3p	CLIP-seq
MIRT1363504	hsa-miR-3118	CLIP-seq
MIRT1363505	hsa-miR-3164	CLIP-seq
MIRT1363506	hsa-miR-3202	CLIP-seq
MIRT1363507	hsa-miR-3663-3p	CLIP-seq
MIRT1363508	hsa-miR-4271	CLIP-seq
MIRT1363509	hsa-miR-4504	CLIP-seq
MIRT1363510	hsa-miR-4690-3p	CLIP-seq
MIRT1363511	hsa-miR-4725-3p	CLIP-seq
MIRT1363512	hsa-miR-4747-5p	CLIP-seq
MIRT1363513	hsa-miR-4768-3p	CLIP-seq
MIRT1363514	hsa-miR-486-3p	CLIP-seq
MIRT1363515	hsa-miR-549	CLIP-seq
MIRT1363516	hsa-miR-665	CLIP-seq
MIRT2107831	hsa-miR-1253	CLIP-seq
MIRT2107832	hsa-miR-223	CLIP-seq
MIRT2107833	hsa-miR-329	CLIP-seq
MIRT2107834	hsa-miR-362-3p	CLIP-seq
MIRT2107835	hsa-miR-377	CLIP-seq
MIRT2107836	hsa-miR-412	CLIP-seq
MIRT2107837	hsa-miR-4252	CLIP-seq
MIRT2107838	hsa-miR-4434	CLIP-seq
MIRT2107839	hsa-miR-4493	CLIP-seq
MIRT2107840	hsa-miR-4516	CLIP-seq
MIRT2107841	hsa-miR-4659a-5p	CLIP-seq
MIRT2107842	hsa-miR-4659b-5p	CLIP-seq
MIRT2107843	hsa-miR-4697-3p	CLIP-seq
MIRT2107844	hsa-miR-4717-5p	CLIP-seq
MIRT2107845	hsa-miR-4753-5p	CLIP-seq
MIRT2107846	hsa-miR-4764-3p	CLIP-seq
MIRT2107847	hsa-miR-4786-3p	CLIP-seq
MIRT2107848	hsa-miR-622	CLIP-seq
MIRT2331630	hsa-miR-1322	CLIP-seq
MIRT2331631	hsa-miR-1913	CLIP-seq
MIRT2331632	hsa-miR-214	CLIP-seq
MIRT1363503	hsa-miR-2467-3p	CLIP-seq
MIRT2331633	hsa-miR-3120-3p	CLIP-seq
MIRT2331634	hsa-miR-3138	CLIP-seq
MIRT2331635	hsa-miR-3189-5p	CLIP-seq
MIRT2331636	hsa-miR-324-3p	CLIP-seq
MIRT2331637	hsa-miR-3605-5p	CLIP-seq
MIRT2331638	hsa-miR-3619-5p	CLIP-seq
MIRT2107835	hsa-miR-377	CLIP-seq
MIRT2331639	hsa-miR-4291	CLIP-seq
MIRT2331640	hsa-miR-4433	CLIP-seq
MIRT2331641	hsa-miR-4459	CLIP-seq
MIRT2331642	hsa-miR-4758-3p	CLIP-seq
MIRT1363513	hsa-miR-4768-3p	CLIP-seq
MIRT2331643	hsa-miR-545	CLIP-seq
MIRT2331644	hsa-miR-571	CLIP-seq
MIRT2331645	hsa-miR-626	CLIP-seq
MIRT2331646	hsa-miR-761	CLIP-seq
MIRT2331647	hsa-miR-922	CLIP-seq
MIRT2394781	hsa-miR-10a	CLIP-seq
MIRT2394782	hsa-miR-10b	CLIP-seq
MIRT2394783	hsa-miR-339-5p	CLIP-seq
MIRT2459754	hsa-miR-4707-5p	CLIP-seq
MIRT2459755	hsa-miR-551a	CLIP-seq
MIRT2459756	hsa-miR-551b	CLIP-seq
MIRT2459757	hsa-miR-877	CLIP-seq
MIRT2626187	hsa-miR-1273f	CLIP-seq
MIRT2626188	hsa-miR-143	CLIP-seq
MIRT2626189	hsa-miR-1915	CLIP-seq
MIRT2626190	hsa-miR-3682-3p	CLIP-seq
MIRT2626191	hsa-miR-4677-3p	CLIP-seq
MIRT2626192	hsa-miR-4708-5p	CLIP-seq
MIRT2626193	hsa-miR-4738-3p	CLIP-seq
MIRT2626194	hsa-miR-4770	CLIP-seq
MIRT2626195	hsa-miR-548g	CLIP-seq
MIRT2626189	hsa-miR-1915	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RREB1	Unknown	21613827

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	ISS
GO:0005385	Function	Zinc ion transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060173	Process	Limb development	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0071577	Process	Zinc ion transmembrane transport	ISS
GO:0071577	Process	Zinc ion transmembrane transport	TAS
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	ISS

MIM	HGNC	e!Ensembl
612168	17128	ENSG00000141873

Protein

UniProt ID

Q9BRY0

Protein name

Zinc transporter ZIP3 (Solute carrier family 39 member 3) (Zrt- and Irt-like protein 3) (ZIP-3)

Protein function

Transporter for the divalent cation Zn(2+). Mediates the influx of Zn(2+) into cells from extracellular space. Controls Zn(2+) accumulation into dentate gyrus granule cells in the hippocampus. Mediates Zn(2+) reuptake from the secreted milk with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02535	Zip	5 → 310	ZIP Zinc transporter	Family

Sequence

MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF
NALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLET
FNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH
SVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMI
PLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV
LGYTVLAGMVFLKW

Sequence length

314

Interactions

View interactions

	KEGG		Reactome
	Alzheimer disease Parkinson disease		Zinc influx into cells by the SLC39 gene family

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Inhibit	21613827, 22427155
Adenocarcinoma of Lung	Associate	33535184
Bipolar Disorder	Associate	27063557
Breast Neoplasms	Associate	32744318
Carcinogenesis	Associate	25050557
Carcinoma Squamous Cell	Associate	33535184
Cleft Palate	Associate	21478106
Drug Related Side Effects and Adverse Reactions	Associate	25050557
Glioma	Associate	23595627
Pancreatic Neoplasms	Associate	21613827, 22427155, 25050557
Prostatic Neoplasms	Inhibit	21940908
Prostatitis	Inhibit	17550612

SLC39A3 (solute carrier family 39 member 3)