Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29978
Gene name Gene Name - the full gene name approved by the HGNC.
Ubiquilin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UBQLN2
Synonyms (NCBI Gene) Gene synonyms aliases
ALS15, CHAP1, DSK2, HRIHFB2157, N4BP4, PLIC2
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs45559331 C>A,T Likely-benign, conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, synonymous variant
rs369947678 C>A,G,T Benign, pathogenic, pathogenic-likely-pathogenic Missense variant, coding sequence variant
rs387906709 C>A,T Pathogenic Missense variant, coding sequence variant
rs387906710 C>T Pathogenic Missense variant, coding sequence variant
rs387906711 C>A,T Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020846 hsa-miR-155-5p Proteomics 18668040
MIRT025411 hsa-miR-34a-5p Proteomics 21566225
MIRT025411 hsa-miR-34a-5p Proteomics 21566225
MIRT025411 hsa-miR-34a-5p Proteomics 21566225
MIRT041770 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IBA
GO:0005515 Function Protein binding IPI 15231748, 17098253, 18199683, 18307982, 18497817, 20059542, 21988832, 23459205, 23541532, 24215460, 24811749, 25616961, 32296183, 32814053, 35914814, 36217029
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 18199683
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300264 12509 ENSG00000188021
Protein
UniProt ID Q9UHD9
Protein name Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)
Protein function Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and the endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the p
PDB 1J8C , 2NBV , 6MUN , 7F7X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 33 105 Ubiquitin family Domain
PF00627 UBA 581 618 UBA/TS-N domain Domain
Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQ
NRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERL
LGSQPS
Sequence length 624
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein processing in endoplasmic reticulum
Amyotrophic lateral sclerosis
  Cargo recognition for clathrin-mediated endocytosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis type 15 rs387906709, rs387906710, rs387906711 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypogonadism Hypogonadism N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35063704
Alzheimer Disease Inhibit 24086754
Alzheimer Disease Associate 34130600
Amyotrophic Lateral Sclerosis Associate 21857683, 22426854, 22766032, 23541532, 24086754, 25681989, 26075709, 28125704, 28430856, 28716533, 30442662, 30982635, 31167121, 32413959, 32731393
View all (8 more)
Amyotrophic lateral sclerosis 1 Associate 21857683, 23541532, 24086754, 25681989, 28125704, 36232630, 37257946
Ataxia Associate 34130600
Brain Diseases Associate 34130600
Carcinoma Hepatocellular Associate 32293796
Chediak Higashi Syndrome Associate 34130600
Chronic Kidney Diseases of Uncertain Etiology Associate 28125704