Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	29970
Gene name	Schwannomin interacting protein 1
Gene symbol	SCHIP1
Synonyms (NCBI Gene)	SCHIP-1
Chromosome	3
Chromosome location	3q25.32-q25.33

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027531	hsa-miR-98-5p	Microarray	19088304
MIRT1329358	hsa-miR-181a	CLIP-seq
MIRT1329359	hsa-miR-181b	CLIP-seq
MIRT1329360	hsa-miR-181c	CLIP-seq
MIRT1329361	hsa-miR-181d	CLIP-seq
MIRT1329362	hsa-miR-196a	CLIP-seq
MIRT1329363	hsa-miR-196b	CLIP-seq
MIRT1329364	hsa-miR-4262	CLIP-seq
MIRT1329365	hsa-miR-4698	CLIP-seq
MIRT1329366	hsa-miR-4719	CLIP-seq
MIRT1329367	hsa-miR-505	CLIP-seq
MIRT1329368	hsa-miR-513b	CLIP-seq
MIRT1329369	hsa-miR-543	CLIP-seq
MIRT1329370	hsa-miR-129-5p	CLIP-seq
MIRT1329371	hsa-miR-1827	CLIP-seq
MIRT1329372	hsa-miR-940	CLIP-seq
MIRT1553239	hsa-miR-139-5p	CLIP-seq
MIRT1329371	hsa-miR-1827	CLIP-seq
MIRT1553240	hsa-miR-4277	CLIP-seq
MIRT1553241	hsa-miR-4659a-3p	CLIP-seq
MIRT1553242	hsa-miR-4659b-3p	CLIP-seq
MIRT1553243	hsa-miR-4778-3p	CLIP-seq
MIRT1553244	hsa-miR-548a-3p	CLIP-seq
MIRT1553245	hsa-miR-548e	CLIP-seq
MIRT1553246	hsa-miR-548f	CLIP-seq
MIRT1553247	hsa-miR-582-5p	CLIP-seq
MIRT1329372	hsa-miR-940	CLIP-seq
MIRT2097677	hsa-miR-200b	CLIP-seq
MIRT2097678	hsa-miR-200c	CLIP-seq
MIRT2097679	hsa-miR-3153	CLIP-seq
MIRT2097680	hsa-miR-429	CLIP-seq
MIRT2097681	hsa-miR-452	CLIP-seq
MIRT2097682	hsa-miR-4668-5p	CLIP-seq
MIRT2097683	hsa-miR-4676-3p	CLIP-seq
MIRT2321930	hsa-miR-4729	CLIP-seq
MIRT1329370	hsa-miR-129-5p	CLIP-seq
MIRT1329371	hsa-miR-1827	CLIP-seq
MIRT1329372	hsa-miR-940	CLIP-seq
MIRT1553244	hsa-miR-548a-3p	CLIP-seq
MIRT1553245	hsa-miR-548e	CLIP-seq
MIRT1553246	hsa-miR-548f	CLIP-seq
MIRT2618363	hsa-miR-140-3p	CLIP-seq
MIRT2618364	hsa-miR-141	CLIP-seq
MIRT2618365	hsa-miR-200a	CLIP-seq
MIRT2618366	hsa-miR-2117	CLIP-seq
MIRT2618367	hsa-miR-3145-3p	CLIP-seq
MIRT2618368	hsa-miR-326	CLIP-seq
MIRT2618369	hsa-miR-330-5p	CLIP-seq
MIRT2618370	hsa-miR-4273	CLIP-seq
MIRT2618371	hsa-miR-4310	CLIP-seq
MIRT2618372	hsa-miR-4453	CLIP-seq
MIRT2618373	hsa-miR-4538	CLIP-seq
MIRT2618374	hsa-miR-4677-5p	CLIP-seq
MIRT2618375	hsa-miR-4766-3p	CLIP-seq
MIRT2618376	hsa-miR-544	CLIP-seq
MIRT2618377	hsa-miR-548p	CLIP-seq
MIRT2618363	hsa-miR-140-3p	CLIP-seq
MIRT2618364	hsa-miR-141	CLIP-seq
MIRT2618365	hsa-miR-200a	CLIP-seq
MIRT2618367	hsa-miR-3145-3p	CLIP-seq
MIRT2618371	hsa-miR-4310	CLIP-seq
MIRT2618375	hsa-miR-4766-3p	CLIP-seq
MIRT2618376	hsa-miR-544	CLIP-seq
MIRT2618377	hsa-miR-548p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20195357, 25950943, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0030054	Component	Cell junction	IBA
GO:0035332	Process	Positive regulation of hippo signaling	IBA
GO:0042802	Function	Identical protein binding	IPI	10669747, 20195357

MIM	HGNC	e!Ensembl
619206	15678	ENSG00000151967

P0DPB3

Protein name

Schwannomin-interacting protein 1 (SCHIP-1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10148	SCHIP-1	255 → 484	Schwannomin-interacting protein 1	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in brain, skeletal muscles and heart. Also expressed in detected in pancreas, kidney, liver, lung, and placenta. {ECO:0000269|PubMed:10669747}.

Sequence

MERSGQRVTTWDCDQGKHSDSDYREDGMDLGSDAGSSSSSSRASSQSNSTKVTPCSECKS
SSSPGGSLDLVSALEDYEEPFPVYQKKVIDEWAPEEDGEEEEEEDERDQRGYRDDRSPAR
EPGDVSARTRSGGGGGRSATTAMPPPVPNGNLHQHDPQDLRHNGNVVVAGRPSCSRGPRR
AIQKPQPAGGRRSGRGPAAGGLCLQPPDGGTCVPEEPPVPPMDWEALEKHLAGLQFREQE
VRNQGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNL
QICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTR
QKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLR
DMTIGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHM
AEKMPAK

Sequence length

487

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial meningioma	Likely pathogenic	rs1423496206	RCV003988764	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE ACUTE RESPIRATORY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Renal Cell	Associate	23887297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Associate	27175695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37535601	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disease	Associate	25052311	★★★★★ ★☆☆☆☆ Found in Text Mining only

SCHIP1 (schwannomin interacting protein 1)