Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	2996
Gene name	Glycophorin E (MNS blood group)
Gene symbol	GYPE
Synonyms (NCBI Gene)	GPEGYPAMNSMiIX
Chromosome	4
Chromosome location	4q31.21
Summary	The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chro

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT1038905	hsa-miR-142-5p	CLIP-seq
MIRT1038906	hsa-miR-340	CLIP-seq
MIRT1038907	hsa-miR-4481	CLIP-seq
MIRT1038908	hsa-miR-4658	CLIP-seq
MIRT1038909	hsa-miR-4745-5p	CLIP-seq
MIRT1038910	hsa-miR-4758-5p	CLIP-seq
MIRT1038911	hsa-miR-583	CLIP-seq
MIRT2240707	hsa-miR-1266	CLIP-seq
MIRT2240708	hsa-miR-2681	CLIP-seq
MIRT2240709	hsa-miR-337-3p	CLIP-seq
MIRT2240710	hsa-miR-3652	CLIP-seq
MIRT2240711	hsa-miR-3664-3p	CLIP-seq
MIRT2240712	hsa-miR-3680	CLIP-seq
MIRT2240713	hsa-miR-4430	CLIP-seq
MIRT2240714	hsa-miR-4505	CLIP-seq
MIRT2240715	hsa-miR-4518	CLIP-seq
MIRT2240716	hsa-miR-4646-5p	CLIP-seq
MIRT2240717	hsa-miR-4747-5p	CLIP-seq
MIRT2240718	hsa-miR-493	CLIP-seq
MIRT2240719	hsa-miR-562	CLIP-seq
MIRT2240720	hsa-miR-580	CLIP-seq
MIRT1038911	hsa-miR-583	CLIP-seq
MIRT2240721	hsa-miR-587	CLIP-seq
MIRT2388883	hsa-miR-139-5p	CLIP-seq
MIRT2240710	hsa-miR-3652	CLIP-seq
MIRT2388884	hsa-miR-4328	CLIP-seq
MIRT2240713	hsa-miR-4430	CLIP-seq
MIRT2240714	hsa-miR-4505	CLIP-seq
MIRT2388885	hsa-miR-450b-5p	CLIP-seq
MIRT2240716	hsa-miR-4646-5p	CLIP-seq
MIRT2240717	hsa-miR-4747-5p	CLIP-seq
MIRT2388886	hsa-miR-507	CLIP-seq
MIRT2388887	hsa-miR-557	CLIP-seq
MIRT2388888	hsa-miR-582-5p	CLIP-seq
MIRT2450908	hsa-miR-3692	CLIP-seq
MIRT2450909	hsa-miR-630	CLIP-seq
MIRT2544215	hsa-miR-1207-3p	CLIP-seq
MIRT2544216	hsa-miR-1301	CLIP-seq
MIRT2544217	hsa-miR-214	CLIP-seq
MIRT2544218	hsa-miR-3619-5p	CLIP-seq
MIRT2544219	hsa-miR-3665	CLIP-seq
MIRT2544220	hsa-miR-3925-5p	CLIP-seq
MIRT2544221	hsa-miR-3944-5p	CLIP-seq
MIRT2544222	hsa-miR-4660	CLIP-seq
MIRT2544223	hsa-miR-4773	CLIP-seq
MIRT2544224	hsa-miR-5047	CLIP-seq
MIRT2544225	hsa-miR-761	CLIP-seq
MIRT2544226	hsa-miR-764	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	2295603, 7622054
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
138590	4705	ENSG00000197465

P15421

Protein name

Glycophorin-E

Protein function

This protein is a minor sialoglycoprotein in human erythrocyte membranes.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Erythrocytes.

Sequence

MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIF
EVMLVVVGMIILISYCIR

Sequence length

Interactions

View interactions

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	rs1132785	RCV005898266
Colorectal cancer	Benign	rs1132785	RCV005898264
Familial cancer of breast	Benign	rs1132785, rs146400730	RCV005898257 RCV005905025
Familial pancreatic carcinoma	Benign	rs1132785	RCV005898262
Hepatocellular carcinoma	Benign	rs1132785	RCV005898258
Lymphoma	Benign	rs1132785	RCV005898265
Malignant lymphoma, large B-cell, diffuse	Benign	rs1132785	RCV005898263
Nonpapillary renal cell carcinoma	Benign	rs1132785	RCV005898259
Ovarian cancer	Benign	rs1132785	RCV005898260
Uveal melanoma	Benign	rs1132785	RCV005898261

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Huntington Disease	Associate	11905993
Respiratory Distress Syndrome	Associate	34898369
Rett Syndrome	Associate	24419315

GYPE (glycophorin E (MNS blood group))