Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2996
Gene name Gene Name - the full gene name approved by the HGNC.
Glycophorin E (MNS blood group)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GYPE
Synonyms (NCBI Gene) Gene synonyms aliases
GPE, GYPA, MNS, MiIX
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MNS
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chro
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1038905 hsa-miR-142-5p CLIP-seq
MIRT1038906 hsa-miR-340 CLIP-seq
MIRT1038907 hsa-miR-4481 CLIP-seq
MIRT1038908 hsa-miR-4658 CLIP-seq
MIRT1038909 hsa-miR-4745-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane TAS 2295603
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138590 4705 ENSG00000197465
Protein
UniProt ID P15421
Protein name Glycophorin-E
Protein function This protein is a minor sialoglycoprotein in human erythrocyte membranes.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Erythrocytes.
Sequence
MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIF
EVMLVVVGMIILISYCIR
Sequence length 78
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 22189158, 3233232 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Huntington Disease Associate 11905993
Respiratory Distress Syndrome Associate 34898369
Rett Syndrome Associate 24419315