Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	29953
Gene name	Thyrotropin releasing hormone degrading enzyme
Gene symbol	TRHDE
Synonyms (NCBI Gene)	PAP-IIPGPEP2TRH-DE
Chromosome	12
Chromosome location	12q21.1
Summary	This gene encodes a member of the peptidase M1 family. The encoded protein is an extracellular peptidase that specifically cleaves and inactivates the neuropeptide thyrotropin-releasing hormone.[provided by RefSeq, Dec 2008]

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments
MIRT1452507	hsa-miR-148a	CLIP-seq
MIRT1452508	hsa-miR-148b	CLIP-seq
MIRT1452509	hsa-miR-152	CLIP-seq
MIRT1452510	hsa-miR-223	CLIP-seq
MIRT1452511	hsa-miR-3668	CLIP-seq
MIRT1452512	hsa-miR-4697-3p	CLIP-seq
MIRT1452513	hsa-miR-4773	CLIP-seq
MIRT2135504	hsa-miR-133a	CLIP-seq
MIRT2135505	hsa-miR-133b	CLIP-seq
MIRT2135506	hsa-miR-3120-3p	CLIP-seq
MIRT2135507	hsa-miR-486-5p	CLIP-seq
MIRT2356661	hsa-miR-187	CLIP-seq
MIRT2356662	hsa-miR-2278	CLIP-seq
MIRT2356663	hsa-miR-3692	CLIP-seq
MIRT2356664	hsa-miR-4711-3p	CLIP-seq
MIRT2462308	hsa-miR-122	CLIP-seq
MIRT2462309	hsa-miR-3165	CLIP-seq
MIRT2462310	hsa-miR-3664-3p	CLIP-seq
MIRT2462311	hsa-miR-548ac	CLIP-seq
MIRT2462312	hsa-miR-548d-3p	CLIP-seq
MIRT2462313	hsa-miR-548z	CLIP-seq
MIRT2462314	hsa-miR-873	CLIP-seq
MIRT2462308	hsa-miR-122	CLIP-seq
MIRT2462309	hsa-miR-3165	CLIP-seq
MIRT2462310	hsa-miR-3664-3p	CLIP-seq
MIRT2462311	hsa-miR-548ac	CLIP-seq
MIRT2462312	hsa-miR-548d-3p	CLIP-seq
MIRT2462313	hsa-miR-548z	CLIP-seq
MIRT2462314	hsa-miR-873	CLIP-seq
MIRT2650143	hsa-miR-1303	CLIP-seq
MIRT2650144	hsa-miR-194	CLIP-seq
MIRT2650145	hsa-miR-34c-3p	CLIP-seq
MIRT2650146	hsa-miR-3614-5p	CLIP-seq
MIRT2650147	hsa-miR-4696	CLIP-seq
MIRT2650148	hsa-miR-4711-5p	CLIP-seq
MIRT2650143	hsa-miR-1303	CLIP-seq
MIRT2650146	hsa-miR-3614-5p	CLIP-seq
MIRT2650147	hsa-miR-4696	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	TAS	10491199
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	TAS	10491199
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007165	Process	Signal transduction	TAS	10491199
GO:0007267	Process	Cell-cell signaling	TAS	10491199
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016920	Function	Pyroglutamyl-peptidase activity	IEA
GO:0043171	Process	Peptide catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
606950	30748	ENSG00000072657

Q9UKU6

Protein name

Thyrotropin-releasing hormone-degrading ectoenzyme (TRH-DE) (TRH-degrading ectoenzyme) (EC 3.4.19.6) (Pyroglutamyl-peptidase II) (PAP-II) (TRH-specific aminopeptidase) (Thyroliberinase)

Protein function

Specific inactivation of TRH after its release.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17900	Peptidase_M1_N	146 → 331		Domain
PF01433	Peptidase_M1	368 → 591	Peptidase family M1 domain	Domain
PF11838	ERAP1_C	678 → 1005	ERAP1-like C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in brain.

Sequence

MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVL
LSLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTT
SAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYV
VLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNAL
IENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLS
LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDA
IRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPG
WNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANF
MGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVI
TILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIW
VSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGL
IDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEY
ILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNL
LNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSK
LISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGK
ALRH

Sequence length

1024

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	21452313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	37247276	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRHDE (thyrotropin releasing hormone degrading enzyme)