Gene Gene information from NCBI Gene database.
Entrez ID 2995
Gene name Glycophorin C (Gerbich blood group)
Gene symbol GYPC
Synonyms (NCBI Gene)
CD236CD236RGEGPCGPDGYPDPAS-2PAS-2'
Chromosome 2
Chromosome location 2q14.3
Summary Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The G
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs121912760 A>G Affects 5 prime UTR variant, genic upstream transcript variant, coding sequence variant, missense variant
rs121912761 C>A,T Affects 5 prime UTR variant, genic upstream transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
43
miRTarBase ID miRNA Experiments Reference
MIRT1038902 hsa-miR-3677-5p CLIP-seq
MIRT1038903 hsa-miR-4757-5p CLIP-seq
MIRT1038904 hsa-miR-643 CLIP-seq
MIRT2544195 hsa-miR-1245b-3p CLIP-seq
MIRT2544196 hsa-miR-2115 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16669616, 32296183
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 8219208
GO:0005886 Component Plasma membrane TAS 2416746
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
110750 4704 ENSG00000136732
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04921
Protein name Glycophorin-C (Glycoconnectin) (Glycophorin-D) (GPD) (Glycoprotein beta) (PAS-2') (Sialoglycoprotein D) (CD antigen CD236)
Protein function This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an importa
PDB 2EJY
Family and domains
Tissue specificity TISSUE SPECIFICITY: Glycophorin-C is expressed in erythrocytes. Glycophorin-D and IsoGPC are ubiquitously expressed. {ECO:0000269|PubMed:2349119}.
Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIV
VIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGD
SSRKEYFI
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Malaria   Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Blood group, Gerbich system Affects rs121912760, rs121912761 RCV000019300
RCV000019302
GYPC-related disorder Uncertain significance; Benign; Likely benign rs115178969, rs143216051, rs115201071, rs28387219 RCV004758182
RCV003910652
RCV003920788
RCV003916031
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32795291
Anemia Associate 34562771
Breast Neoplasms Associate 25774687
Carcinogenesis Associate 32795291
Cardiomyopathy Dilated Associate 36042172
Cholestasis Stimulate 38003603
Diabetic Nephropathies Associate 37986381
Elliptocytosis 1 Associate 8353290
Elliptocytosis Hereditary Associate 11719395, 1430200
Endometrial Neoplasms Associate 36001862