DNMT3L (DNA methyltransferase 3 like)

Gene

• Entrez ID: 29947
• Gene name: DNA methyltransferase 3 like
• Gene symbol: DNMT3L
• Synonyms (NCBI Gene): -
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000792	Component	Heterochromatin	IEA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0001890	Process	Placenta development	IEA
GO:0005515	Function	Protein binding	IPI	12202768, 16189514, 17713477, 25383530, 25416956, 32296183
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	12202768, 25383530, 32083663
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	ISS
GO:0007141	Process	Male meiosis I	IEA
GO:0007141	Process	Male meiosis I	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007283	Process	Spermatogenesis	NAS	11934864
GO:0008047	Function	Enzyme activator activity	IBA
GO:0008047	Function	Enzyme activator activity	IDA	16543361
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0019899	Function	Enzyme binding	IPI	12202768
GO:0030154	Process	Cell differentiation	IEA
GO:0032259	Process	Methylation	IEA
GO:0035098	Component	ESC/E(Z) complex	IEA
GO:0035098	Component	ESC/E(Z) complex	ISS
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IEA
GO:0044726	Process	Epigenetic programing of female pronucleus	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IDA	12202768
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048863	Process	Stem cell differentiation	ISS
GO:0060718	Process	Chorionic trophoblast cell differentiation	IEA
GO:0071514	Process	Genomic imprinting	IEA
GO:0071514	Process	Genomic imprinting	ISS
GO:0090310	Process	Negative regulation of DNA methylation-dependent heterochromatin formation	IEA
GO:0090310	Process	Negative regulation of DNA methylation-dependent heterochromatin formation	ISS
GO:0141005	Process	Transposable element silencing by heterochromatin formation	IEA
GO:0141005	Process	Transposable element silencing by heterochromatin formation	ISS
GO:0141068	Process	Autosome genomic imprinting	IEA
GO:0141196	Process	Transposable element silencing by piRNA-mediated DNA methylation	IEA
GO:1902494	Component	Catalytic complex	IPI	25383530, 32083663

Other IDs

• MIM: 606588
• HGNC: 2980
• e!Ensembl: ENSG00000142182

Protein

• UniProt ID: Q9UJW3
• Protein name: DNA (cytosine-5)-methyltransferase 3-like
• Protein function: Catalytically inactive regulatory factor of DNA methyltransferases that can either promote or inhibit DNA methylation depending on the context (By similarity). Essential for the function of DNMT3A and DNMT3B: activates DNMT3A and DNMT3B by bindi
• PDB: 2PV0, 2PVC, 2QRV, 4U7P, 4U7T, 5YX2, 6BRR, 6F57, 6KDA, 6KDB, 6KDL, 6KDP, 6KDT, 6U8P, 6U8V, 6U8W, 6U8X, 6U90, 6U91, 6W89, 6W8B, 6W8D, 6W8J, 7X9D, 8TCI, 8XEE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17980	ADD_DNMT3	34 → 89	Cysteine rich ADD domain in DNMT3	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in several tissues including testis, ovary, and thymus. {ECO:0000269|PubMed:10857753}.
• Sequence:

  MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQ
  VHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFE
  CVDSLVGPGTSGKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFE
  TVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDL
  VYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASR
  FLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSKLAAKWP
  TKLVKNCFLPLREYFKYFSTELTSSL

• Sequence length: 386