Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29945
Gene name Gene Name - the full gene name approved by the HGNC.
Anaphase promoting complex subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANAPC4
Synonyms (NCBI Gene) Gene synonyms aliases
APC4
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022718 hsa-miR-124-3p Proteomics;Microarray 18668037
Transcription factors
Transcription factor Regulation Reference
YBX1 Repression 20596676
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity TAS 6180011
GO:0005515 Function Protein binding IPI 20360068, 21241890, 23288039, 25383541, 26083744, 26496610, 34595750, 35271311
GO:0005634 Component Nucleus IDA 18445686, 21241890
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606947 19990 ENSG00000053900
Protein
UniProt ID Q9UJX5
Protein name Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4)
Protein function Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit
PDB 4UI9 , 5A31 , 5BPW , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12894 ANAPC4_WD40 26 118 Anaphase-promoting complex subunit 4 WD40 domain Repeat
PF12896 ANAPC4 232 431 Anaphase-promoting complex, cyclosome, subunit 4 Domain
Sequence
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEV
TV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTED
HVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCI
LRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESE
AENQQAGAAALAPEIVIKVEKLDPELDS
Sequence length 808
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Human T-cell leukemia virus 1 infection
  Inactivation of APC/C via direct inhibition of the APC/C complex
APC/C:Cdc20 mediated degradation of Cyclin B
Autodegradation of Cdh1 by Cdh1:APC/C
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
APC/C:Cdc20 mediated degradation of mitotic proteins
Phosphorylation of the APC/C
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Senescence-Associated Secretory Phenotype (SASP)
CDK-mediated phosphorylation and removal of Cdc6
Transcriptional Regulation by VENTX
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Triple-negative breast cancer Following CRISPR editing or siRNA knockdown, we conducted colony survival assays to determine the effects of gene manipulation on sensitivity to CFI-402257. Both of these methods confirmed that ANAPC4, ANAPC13, and MAD2L1BP mediate CFI-402257 response in 29378962 CBGDA
Diabetes Type 2 diabetes N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Neoplasms Associate 26152289
Squamous Cell Carcinoma of Head and Neck Associate 26152289