Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29945
Gene name Gene Name - the full gene name approved by the HGNC.	Anaphase promoting complex subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANAPC4
Synonyms (NCBI Gene) Gene synonyms aliases	APC4
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p15.2
Summary Summary of gene provided in NCBI Entrez Gene.	A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022718	hsa-miR-124-3p	Proteomics;Microarray	18668037

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YBX1	Repression	20596676

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	6180011
GO:0005515	Function	Protein binding	IPI	20360068, 21241890, 23288039, 25383541, 26083744, 26496610, 34595750, 35271311
GO:0005634	Component	Nucleus	IDA	18445686, 21241890
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	16364912, 21926987
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005829	Component	Cytosol	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	21241890
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0034399	Component	Nuclear periphery	IBA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
606947	19990	ENSG00000053900

Protein

UniProt ID

Q9UJX5

Protein name

Anaphase-promoting complex subunit 4 (APC4) (Cyclosome subunit 4)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

4UI9 , 5A31 , 5BPW , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12894	ANAPC4_WD40	26 → 118	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
PF12896	ANAPC4	232 → 431	Anaphase-promoting complex, cyclosome, subunit 4	Domain

Sequence

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCI
LRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESE
AENQQAGAAALAPEIVIKVEKLDPELDS

Sequence length

808

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Triple-negative breast cancer	Following CRISPR editing or siRNA knockdown, we conducted colony survival assays to determine the effects of gene manipulation on sensitivity to CFI-402257. Both of these methods confirmed that ANAPC4, ANAPC13, and MAD2L1BP mediate CFI-402257 response in	29378962	CBGDA
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Neoplasms	Associate	26152289
Squamous Cell Carcinoma of Head and Neck	Associate	26152289

ANAPC4 (anaphase promoting complex subunit 4)