Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2993
Gene name	Glycophorin A (MNS blood group)
Gene symbol	GYPA
Synonyms (NCBI Gene)	CD235aGPAGPErikGPSATHGpMiVHGpMiXIHGpSta(C)MNMNSPAS-2
Chromosome	4
Chromosome location	4q31.21
Summary	Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, a

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529014	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT529013	hsa-miR-944	PAR-CLIP	22012620
MIRT529012	hsa-miR-4778-5p	PAR-CLIP	22012620
MIRT529011	hsa-miR-3137	PAR-CLIP	22012620
MIRT529010	hsa-miR-20b-3p	PAR-CLIP	22012620
MIRT529009	hsa-miR-3686	PAR-CLIP	22012620
MIRT529007	hsa-miR-4320	PAR-CLIP	22012620
MIRT529014	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT529013	hsa-miR-944	PAR-CLIP	22012620
MIRT529012	hsa-miR-4778-5p	PAR-CLIP	22012620
MIRT529011	hsa-miR-3137	PAR-CLIP	22012620
MIRT529010	hsa-miR-20b-3p	PAR-CLIP	22012620
MIRT529009	hsa-miR-3686	PAR-CLIP	22012620
MIRT529007	hsa-miR-4320	PAR-CLIP	22012620
MIRT1038885	hsa-miR-1299	CLIP-seq
MIRT1038886	hsa-miR-142-5p	CLIP-seq
MIRT1038887	hsa-miR-186	CLIP-seq
MIRT1038888	hsa-miR-216a	CLIP-seq
MIRT1038889	hsa-miR-216b	CLIP-seq
MIRT1038890	hsa-miR-3117-3p	CLIP-seq
MIRT1038891	hsa-miR-3133	CLIP-seq
MIRT1038892	hsa-miR-3169	CLIP-seq
MIRT1038893	hsa-miR-340	CLIP-seq
MIRT1038894	hsa-miR-3591-5p	CLIP-seq
MIRT1038895	hsa-miR-3657	CLIP-seq
MIRT1038896	hsa-miR-4652-3p	CLIP-seq
MIRT1038897	hsa-miR-4759	CLIP-seq
MIRT1038898	hsa-miR-4766-3p	CLIP-seq
MIRT1038899	hsa-miR-548p	CLIP-seq
MIRT1038900	hsa-miR-562	CLIP-seq
MIRT1038901	hsa-miR-875-3p	CLIP-seq
MIRT2008017	hsa-miR-2113	CLIP-seq
MIRT2008018	hsa-miR-3646	CLIP-seq
MIRT2008019	hsa-miR-491-3p	CLIP-seq
MIRT2008020	hsa-miR-586	CLIP-seq
MIRT2008021	hsa-miR-599	CLIP-seq
MIRT2240704	hsa-miR-1256	CLIP-seq
MIRT2240705	hsa-miR-4642	CLIP-seq
MIRT2240706	hsa-miR-561	CLIP-seq
MIRT1038896	hsa-miR-4652-3p	CLIP-seq
MIRT2450907	hsa-miR-513a-3p	CLIP-seq
MIRT1038896	hsa-miR-4652-3p	CLIP-seq
MIRT2450907	hsa-miR-513a-3p	CLIP-seq
MIRT1038896	hsa-miR-4652-3p	CLIP-seq
MIRT2450907	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
LMO2	Repression	18844071

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	19438409, 23219802, 24297912, 25910212, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8245024
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3456608
GO:0042802	Function	Identical protein binding	IPI	15067009, 23155421
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0170014	Component	Ankyrin-1 complex	IDA	35835865
GO:0170014	Component	Ankyrin-1 complex	IEA

MIM	HGNC	e!Ensembl
617922	4702	ENSG00000170180

P02724

Protein name

Glycophorin-A (MN sialoglycoprotein) (PAS-2) (Sialoglycoprotein alpha) (CD antigen CD235a)

Protein function

Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed:35835865). Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated s

PDB

1AFO , 2KPE , 2KPF , 5EH4 , 5EH6 , 7UZ3 , 7V07 , 7V0K , 7V19 , 8CRQ , 8CRR , 8CRT , 8CS9 , 8CSL , 8CT3 , 8CTE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01102	Glycophorin_A	34 → 146		Family

Sequence

MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAH
EVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
SPSDVKPLPSPDTDVPLSSVEIENPETSDQ

Sequence length

150

Interactions

View interactions

	KEGG		Reactome
	Hematopoietic cell lineage Malaria		Cell surface interactions at the vascular wall

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
BLOOD GROUP ERIK	Pathogenic	rs1800582	RCV000019288

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acidosis Renal Tubular	Associate	10926824
Anemia Aplastic	Associate	9266937
Anemia Diamond Blackfan	Associate	3498522
Anemia Sickle Cell	Associate	15145217, 30972754, 32987729
Ataxia Telangiectasia	Associate	2916583
beta Thalassemia	Associate	11146156
Bloom Syndrome	Associate	2911598
Carcinoma Renal Cell	Associate	35955933
Cerulean cataract	Inhibit	35583991
COVID 19	Associate	35964959
Diabetes Mellitus Type 2	Associate	33430853
Diabetic Neuropathies	Associate	33430853
Down Syndrome	Associate	12728455
Fanconi Anemia	Associate	15822129
Fever	Stimulate	18097851
Genetic Diseases Inborn	Associate	15565952
Hemoglobinuria Paroxysmal	Associate	2185273, 9266937
Hemophagocytic Lymphohistiocytosis Familial 5	Inhibit	26320718
HIV Infections	Associate	25716234
Leukemia	Associate	7689892
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	6576813
Leukemia Myeloid	Associate	14521454
Limbal Stem Cell Deficiency	Associate	9266937
Lung Diseases	Associate	11254223
Lung Neoplasms	Associate	21119205
Multiple Myeloma	Associate	11830480
Myelodysplastic Syndromes	Inhibit	22160620
Myelodysplastic Syndromes	Associate	9266937
Neoplasms	Associate	21237494, 2916583, 3477806, 3755722, 8781371
Neoplasms	Inhibit	2295603
Neuroblastoma	Associate	36571449
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis	Associate	26320718
Ovarian Diseases	Associate	21237494
Ovarian Neoplasms	Associate	35038288
Polycythemia Vera	Associate	17452518, 9475763
Pulmonary Disease Chronic Obstructive	Associate	21119205
Scleroderma Diffuse	Associate	15565952
Scleroderma Systemic	Associate	15565952
Thrombosis	Associate	26239059
Venous Thromboembolism	Stimulate	34861826

GYPA (glycophorin A (MNS blood group))