Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29926
Gene name Gene Name - the full gene name approved by the HGNC.
GDP-mannose pyrophosphorylase A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GMPPA
Synonyms (NCBI Gene) Gene synonyms aliases
AAMR
Disease Acronyms (UniProt) Disease acronyms from UniProt database
AAMR
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020875 hsa-miR-155-5p Proteomics 18668040
MIRT052838 hsa-miR-4326 CLASH 23622248
MIRT2003119 hsa-miR-1237 CLIP-seq
MIRT2003120 hsa-miR-1289 CLIP-seq
MIRT2003121 hsa-miR-1299 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 26871637, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0009058 Process Biosynthetic process IEA
GO:0016779 Function Nucleotidyltransferase activity IEA
GO:0070062 Component Extracellular exosome HDA 23533145
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615495 22923 ENSG00000144591
Protein
UniProt ID Q96IJ6
Protein name Mannose-1-phosphate guanylyltransferase regulatory subunit alpha (GDP-mannose pyrophosphorylase A) (GMPP-alpha) (GTP-mannose-1-phosphate guanylyltransferase alpha)
Protein function Regulatory subunit of the GMPPA-GMPPB mannose-1-phosphate guanylyltransferase complex; reduces the catalytic activity of GMPPB when part of the complex (PubMed:24035193, PubMed:33986552). Mediates allosteric feedback inhibition of GMPPB catalyti
PDB 7D72 , 7D73 , 7D74
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00483 NTP_transferase 3 209 Nucleotidyl transferase Family
PF00132 Hexapep 280 321 Bacterial transferase hexapeptide (six repeats) Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in fibroblasts (at protein level). {ECO:0000269|PubMed:24035193}.
Sequence
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQ
PDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSD
FPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIIN
CGIYLFSPEALKPLRDVFQRNQQDGQLED
SPGLWPGAGTIRLEQDVFSALAGQGQIYVHL
TDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGGPWIRGNVYIHPTAKVAPSAV
LGPNVSIGKGVTVGEGVRLRE
SIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDP
NPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
Sequence length 420
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of cofactors
Biosynthesis of nucleotide sugars
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alacrima, achalasia, and mental retardation syndrome ALACRIMA, ACHALASIA, AND MENTAL RETARDATION SYNDROME rs397518460, rs397518461, rs886037654, rs2125639654, rs1553624347 24035193
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Developmental regression Developmental regression rs1224421127
Glucocorticoid deficiency with achalasia Glucocorticoid deficiency with achalasia rs121918547, rs121918548, rs387906326, rs1565781382, rs121918549, rs121918550, rs1035139364, rs754637718, rs773601814, rs150511103, rs770214071, rs552637666, rs746305979, rs766542823, rs1592513048
View all (2 more)
24035193
Associations from Text Mining
Disease Name Relationship Type References
Achalasia Addisonianism Alacrimia syndrome Associate 24035193, 35665995
Adenocarcinoma of Lung Associate 30419062
Adrenal Insufficiency Associate 24035193
Alacrima Associate 24035193, 35665995
Autonomic Nervous System Diseases Associate 24035193
Congenital Disorders of Glycosylation Associate 24035193, 35665995
Developmental Disabilities Associate 35665995
Esophageal Achalasia Associate 24035193, 35665995
Gait Disorders Neurologic Associate 24035193
Intellectual Disability Associate 24035193, 35665995