Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29922
Gene name Gene Name - the full gene name approved by the HGNC.	NME/NM23 family member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NME7
Synonyms (NCBI Gene) Gene synonyms aliases	CFAP67, MN23H7, NDK 7, NDK7, nm23-H7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two k

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000931	Component	Gamma-tubulin ring complex	IDA	24807905
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	IEA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	16313181, 24807905
GO:0004672	Function	Protein kinase activity	IDA	34764205
GO:0004672	Function	Protein kinase activity	IMP	24807905
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 21988832, 25416956, 26638075, 27107012, 27173435, 29892012, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	24807905
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24807905
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614, 24807905, 38538594, 39824631
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IBA
GO:0005879	Component	Axonemal microtubule	IDA	36191189, 37258679
GO:0005879	Component	Axonemal microtubule	IEA
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IDA	38538594, 39824631
GO:0005929	Component	Cilium	IEA
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0006308	Process	DNA catabolic process	IDA	16313181
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007420	Process	Brain development	IEA
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	16313181
GO:0010968	Process	Regulation of microtubule nucleation	IMP	24807905
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IDA	39824631
GO:0036064	Component	Ciliary basal body	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042073	Process	Intraciliary transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043113	Process	Receptor clustering	IEA
GO:0060271	Process	Cilium assembly	IDA	39824631
GO:0060972	Process	Left/right pattern formation	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
613465	20461	ENSG00000143156

Protein

UniProt ID

Q9Y5B8

Protein name

Nucleoside diphosphate kinase homolog 7 (NDK 7) (NDP kinase homolog 7) (3'-5' exonuclease NME7) (EC 3.1.-.-) (Protein kinase NME7) (EC 2.7.-.-) (nm23-H7)

Protein function

Possesses an intrinsic kinase activity (PubMed:24807905). Displays 3'-5' exonuclease activity with a preference for single-stranded DNA (PubMed:16313181). Does not seem to have nucleoside diphosphate kinase activity (PubMed:16313181, PubMed:2480

PDB

7UNG , 8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00334	NDK	92 → 226	Nucleoside diphosphate kinase	Domain
PF00334	NDK	238 → 375	Nucleoside diphosphate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.

Sequence

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDL
FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTI
TKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPAN
SGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT
CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT
EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
EDGLLEVQYFFKILDN

Sequence length

376

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Recruitment of mitotic centrosome proteins and complexes Recruitment of NuMA to mitotic centrosomes

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Endometriosis	Endometriosis	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Situs Inversus	situs inversus	N/A	N/A	GenCC

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	25311278
Asthma	Associate	39217320
Hydrocephalus	Associate	27060491
Neoplasms	Associate	31912669
Parkinson Disease	Associate	40240887
Situs Inversus	Associate	27060491
Venous Thromboembolism	Associate	22672568, 28301549

NME7 (NME/NM23 family member 7)