Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29922
Gene name Gene Name - the full gene name approved by the HGNC.	NME/NM23 family member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NME7
Synonyms (NCBI Gene) Gene synonyms aliases	CFAP67, MN23H7, NDK 7, NDK7, nm23-H7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two k

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 21988832, 25416956, 26638075, 27107012, 27173435, 29892012, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	TAS
GO:0006165	Process	Nucleoside diphosphate phosphorylation	IEA
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
613465	20461	ENSG00000143156

Protein

UniProt ID

Q9Y5B8

Protein name

Nucleoside diphosphate kinase homolog 7 (NDK 7) (NDP kinase homolog 7) (3'-5' exonuclease NME7) (EC 3.1.-.-) (Protein kinase NME7) (EC 2.7.-.-) (nm23-H7)

Protein function

Possesses an intrinsic kinase activity (PubMed:24807905). Displays 3'-5' exonuclease activity with a preference for single-stranded DNA (PubMed:16313181). Does not seem to have nucleoside diphosphate kinase activity (PubMed:16313181, PubMed:2480

PDB

7UNG , 8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00334	NDK	92 → 226	Nucleoside diphosphate kinase	Domain
PF00334	NDK	238 → 375	Nucleoside diphosphate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.

Sequence

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDL
FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTI
TKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPAN
SGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT
CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT
EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
EDGLLEVQYFFKILDN

Sequence length

376

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Recruitment of mitotic centrosome proteins and complexes Recruitment of NuMA to mitotic centrosomes

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Gastrointestinal stromal tumor	Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma	rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512 View all (59 more)	27793025
Situs inversus	Situs Inversus	rs528302390, rs1596264554	27060491

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Situs Inversus	situs inversus	GenCC
Myocardial Infarction	Myocardial Infarction	GWAS
Endometriosis	Endometriosis	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	25311278
Asthma	Associate	39217320
Hydrocephalus	Associate	27060491
Neoplasms	Associate	31912669
Parkinson Disease	Associate	40240887
Situs Inversus	Associate	27060491
Venous Thromboembolism	Associate	22672568, 28301549

NME7 (NME/NM23 family member 7)